Figure 1:
Protein profile heatmap (Cell colour represents the log2(ratio) to the average abundance across different samples)
Figure 2.
The volcano plot for proteins.
|
Figure 3.
The distribution of feature vector ratio:
(a)
By quality;
(b)
By abundance.
|
|
Figure 4.
(a)
RT shift distribution;
(b)
M/Z shift distribution.
|
|
Figure 5.
Percentage of missing values in each sample with or without ID transfer.
|
|
|
||||||||||||||||||||||||||||||||||||
|
|
|||||||||||||||||||||||||||||||||||||
|
| Protein Accession Contains: |
| Protein Description Contains: |
| Protein PTM Contains: |
| Protein Group | Protein ID | Accession | Significance | Coverage (%) | #Peptides | #Unique | PTM | Avg. Mass | Sample Profile | Group Profile | Description |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 50 | 24 | P63039|CH60_RAT | 200.00 | 12 | 8 | 8 | Y | 60956 |  |
 |
60 kDa heat shock protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hspd1 PE=1 SV=1 |
| 59 | 965 | Q9JIL3|ILF3_RAT | 200.00 | 17 | 11 | 11 | Y | 95935 |  |
 |
Interleukin enhancer-binding factor 3 OS=Rattus norvegicus OX=10116 GN=Ilf3 PE=1 SV=2 |
| 59 | 23212 | tr|A0A0G2K2T6|A0A0G2K2T6_RAT | 200.00 | 17 | 11 | 11 | Y | 96506 | |
|
Interleukin enhancer binding factor 3 OS=Rattus norvegicus OX=10116 GN=Ilf3 PE=1 SV=2 |
| 59 | 23213 | tr|A0A0G2K4U6|A0A0G2K4U6_RAT | 200.00 | 17 | 11 | 11 | Y | 95859 | |
|
Interleukin enhancer binding factor 3 OS=Rattus norvegicus OX=10116 GN=Ilf3 PE=1 SV=2 |
| 60 | 22565 | tr|A0A8L2Q7B9|A0A8L2Q7B9_RAT | 200.00 | 7 | 2 | 2 | N | 57625 |  |
 |
Pyruvate kinase OS=Rattus norvegicus OX=10116 GN=Pkm PE=1 SV=1 |
| 62 | 1100 | P27008|PARP1_RAT | 200.00 | 13 | 9 | 9 | Y | 112660 |  |
 |
Poly [ADP-ribose] polymerase 1 OS=Rattus norvegicus OX=10116 GN=Parp1 PE=1 SV=4 |
| 68 | 368 | Q3B8Q1|DDX21_RAT | 200.00 | 10 | 6 | 6 | Y | 85966 |  |
 |
Nucleolar RNA helicase 2 OS=Rattus norvegicus OX=10116 GN=Ddx21 PE=2 SV=1 |
| 80 | 22703 | tr|A0A8I6ABZ7|A0A8I6ABZ7_RAT | 200.00 | 12 | 12 | 12 | Y | 150232 |  |
 |
RNA helicase OS=Rattus norvegicus OX=10116 GN=Dhx9 PE=1 SV=1 |
| 80 | 22694 | tr|D4A9D6|D4A9D6_RAT | 200.00 | 14 | 12 | 12 | Y | 131731 | |
|
RNA helicase OS=Rattus norvegicus OX=10116 GN=Dhx9 PE=1 SV=1 |
| 101 | 1010 | P0DMW0|HS71A_RAT | 200.00 | 6 | 3 | 3 | Y | 70185 |  |
 |
Heat shock 70 kDa protein 1A OS=Rattus norvegicus OX=10116 GN=Hspa1a PE=1 SV=1 |
| 101 | 1011 | P0DMW1|HS71B_RAT | 200.00 | 6 | 3 | 3 | Y | 70185 | |
|
Heat shock 70 kDa protein 1B OS=Rattus norvegicus OX=10116 GN=Hspa1b PE=2 SV=1 |
| 101 | 23234 | tr|A0A8L2RAM6|A0A8L2RAM6_RAT | 200.00 | 6 | 3 | 3 | Y | 74719 | |
|
Heat shock protein family A (Hsp70) member 1B OS=Rattus norvegicus OX=10116 GN=Hspa1b PE=1 SV=1 |
| 124 | 22589 | tr|A0A8I6ANE0|A0A8I6ANE0_RAT | 200.00 | 14 | 5 | 5 | Y | 73161 |  |
 |
Dihydropyrimidinase-related protein 2 OS=Rattus norvegicus OX=10116 GN=Dpysl2 PE=1 SV=1 |
| 129 | 2087 | P31000|VIME_RAT | 200.00 | 8 | 3 | 3 | Y | 53733 |  |
|
Vimentin OS=Rattus norvegicus OX=10116 GN=Vim PE=1 SV=2 |
| 154 | 3881 | Q63598|PLST_RAT | 200.00 | 11 | 4 | 4 | Y | 70680 |  |
 |
Plastin-3 OS=Rattus norvegicus OX=10116 GN=Pls3 PE=1 SV=2 |
| 160 | 32 | P20156|VGF_RAT | 200.00 | 3 | 1 | 1 | N | 68179 |  |
 |
Neurosecretory protein VGF OS=Rattus norvegicus OX=10116 GN=Vgf PE=1 SV=3 |
| 160 | 22572 | tr|F1LP80|F1LP80_RAT | 200.00 | 3 | 1 | 1 | N | 68194 | |
|
Neurosecretory protein VGF OS=Rattus norvegicus OX=10116 GN=Vgf PE=4 SV=2 |
| 194 | 23737 | tr|A0A8L2UI37|A0A8L2UI37_RAT | 200.00 | 6 | 4 | 4 | Y | 83500 |  |
 |
TNF receptor-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Trap1 PE=1 SV=1 |
| 194 | 1919 | Q5XHZ0|TRAP1_RAT | 200.00 | 7 | 4 | 4 | Y | 80461 | |
|
Heat shock protein 75 kDa, mitochondrial OS=Rattus norvegicus OX=10116 GN=Trap1 PE=1 SV=1 |
| 194 | 23736 | tr|A0A8I6GKV1|A0A8I6GKV1_RAT | 200.00 | 7 | 4 | 4 | Y | 77854 | |
|
TNF receptor-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Trap1 PE=1 SV=1 |
| 222 | 23392 | tr|Q566E4|Q566E4_RAT | 200.00 | 14 | 7 | 7 | Y | 70874 |  |
 |
Heterogeneous nuclear ribonucleoprotein R OS=Rattus norvegicus OX=10116 GN=Hnrnpr PE=1 SV=1 |
| 226 | 620 | Q9QVC8|FKBP4_RAT | 200.00 | 19 | 6 | 6 | Y | 51450 |  |
 |
Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Rattus norvegicus OX=10116 GN=Fkbp4 PE=1 SV=3 |
| 227 | 373 | P50398|GDIA_RAT | 200.00 | 12 | 4 | 4 | Y | 50537 |  |
 |
Rab GDP dissociation inhibitor alpha OS=Rattus norvegicus OX=10116 GN=Gdi1 PE=1 SV=1 |
| 227 | 22787 | tr|A0A8I5ZR55|A0A8I5ZR55_RAT | 200.00 | 12 | 4 | 4 | Y | 49805 | |
|
Rab GDP dissociation inhibitor OS=Rattus norvegicus OX=10116 GN=Gdi1 PE=1 SV=1 |
| 237 | 22942 | tr|M0R5J4|M0R5J4_RAT | 200.00 | 7 | 3 | 3 | Y | 47075 |  |
 |
phosphopyruvate hydratase OS=Rattus norvegicus OX=10116 GN=Eno1 PE=1 SV=1 |
| 237 | 643 | P04764|ENOA_RAT | 200.00 | 7 | 3 | 3 | Y | 47128 | |
|
Alpha-enolase OS=Rattus norvegicus OX=10116 GN=Eno1 PE=1 SV=4 |
| 268 | 22984 | tr|A0A8L2Q996|A0A8L2Q996_RAT | 200.00 | 11 | 2 | 2 | Y | 50620 |  |
 |
Elongation factor 1-alpha OS=Rattus norvegicus OX=10116 GN=Eef1a2 PE=3 SV=1 |
| 268 | 687 | P62632|EF1A2_RAT | 200.00 | 11 | 2 | 2 | Y | 50454 | |
|
Elongation factor 1-alpha 2 OS=Rattus norvegicus OX=10116 GN=Eef1a2 PE=1 SV=1 |
| 277 | 436 | Q07009|CAN2_RAT | 200.00 | 4 | 2 | 2 | Y | 79919 |  |
 |
Calpain-2 catalytic subunit OS=Rattus norvegicus OX=10116 GN=Capn2 PE=1 SV=3 |
| 295 | 1617 | Q6AXS5|SERB1_RAT | 200.00 | 22 | 7 | 7 | Y | 44754 |  |
 |
SERPINE1 mRNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Serbp1 PE=1 SV=2 |
| 339 | 913 | P07335|KCRB_RAT | 200.00 | 35 | 9 | 9 | Y | 42725 |  |
 |
Creatine kinase B-type OS=Rattus norvegicus OX=10116 GN=Ckb PE=1 SV=2 |
| 339 | 23155 | tr|A0A8L2Q875|A0A8L2Q875_RAT | 200.00 | 35 | 9 | 9 | Y | 43018 | |
|
Creatine kinase B-type OS=Rattus norvegicus OX=10116 GN=Ckb PE=1 SV=1 |
| 340 | 1127 | P60123|RUVB1_RAT | 200.00 | 42 | 13 | 13 | Y | 50214 |  |
 |
RuvB-like 1 OS=Rattus norvegicus OX=10116 GN=Ruvbl1 PE=1 SV=1 |
| 342 | 22972 | tr|A0A8I5ZV89|A0A8I5ZV89_RAT | 200.00 | 4 | 1 | 1 | N | 55442 |  |
 |
Aromatic-L-amino-acid decarboxylase OS=Rattus norvegicus OX=10116 GN=Ddc PE=1 SV=1 |
| 342 | 22973 | tr|A0A8L2Q249|A0A8L2Q249_RAT | 200.00 | 4 | 1 | 1 | N | 57760 | |
|
Aromatic-L-amino-acid decarboxylase OS=Rattus norvegicus OX=10116 GN=Ddc PE=1 SV=1 |
| 342 | 793 | P14173|DDC_RAT | 200.00 | 4 | 1 | 1 | N | 54053 | |
|
Aromatic-L-amino-acid decarboxylase OS=Rattus norvegicus OX=10116 GN=Ddc PE=1 SV=1 |
| 346 | 23163 | tr|F1LNF1|F1LNF1_RAT | 200.00 | 25 | 5 | 5 | Y | 37430 |  |
 |
Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Rattus norvegicus OX=10116 GN=Hnrnpa2b1 PE=1 SV=2 |
| 354 | 23627 | tr|A0A8I6AEH8|A0A8I6AEH8_RAT | 200.00 | 10 | 7 | 7 | N | 76655 |  |
 |
Protein disulfide-isomerase OS=Rattus norvegicus OX=10116 GN=Pdia4 PE=1 SV=1 |
| 354 | 23635 | tr|G3V6T7|G3V6T7_RAT | 200.00 | 10 | 7 | 7 | N | 72748 | |
|
Protein disulfide-isomerase A4 OS=Rattus norvegicus OX=10116 GN=Pdia4 PE=3 SV=1 |
| 366 | 2634 | P42123|LDHB_RAT | 200.00 | 15 | 4 | 4 | N | 36612 |  |
 |
L-lactate dehydrogenase B chain OS=Rattus norvegicus OX=10116 GN=Ldhb PE=1 SV=2 |
| 424 | 23728 | tr|D4A6A2|D4A6A2_RAT | 200.00 | 4 | 1 | 1 | Y | 34113 |  |
 |
Heterogeneous nuclear ribonucleoprotein A3-like OS=Rattus norvegicus OX=10116 GN=LOC100911361 PE=1 SV=4 |
| 424 | 23729 | tr|F1M6C7|F1M6C7_RAT | 200.00 | 4 | 1 | 1 | Y | 35628 | |
|
Heterogeneous nuclear ribonucleoprotein A3-like OS=Rattus norvegicus OX=10116 GN=LOC120096281 PE=1 SV=4 |
| 437 | 607 | P56574|IDHP_RAT | 200.00 | 6 | 2 | 2 | Y | 50967 |  |
 |
Isocitrate dehydrogenase [NADP], mitochondrial OS=Rattus norvegicus OX=10116 GN=Idh2 PE=1 SV=2 |
| 453 | 1133 | Q9JHU0|DPYL5_RAT | 200.00 | 5 | 2 | 2 | N | 61540 |  |
 |
Dihydropyrimidinase-related protein 5 OS=Rattus norvegicus OX=10116 GN=Dpysl5 PE=1 SV=1 |
| 489 | 1588 | P68511|1433F_RAT | 200.00 | 23 | 5 | 5 | N | 28212 |  |
 |
14-3-3 protein eta OS=Rattus norvegicus OX=10116 GN=Ywhah PE=1 SV=2 |
| 494 | 24031 | tr|A0A8I6GKM0|A0A8I6GKM0_RAT | 200.00 | 32 | 10 | 10 | Y | 40510 |  |
 |
Interleukin enhancer binding factor 2 OS=Rattus norvegicus OX=10116 GN=Ilf2 PE=1 SV=1 |
| 494 | 24032 | tr|B2RZC6|B2RZC6_RAT | 200.00 | 30 | 10 | 10 | Y | 43062 | |
|
Interleukin enhancer binding factor 2 OS=Rattus norvegicus OX=10116 GN=Ilf2 PE=4 SV=1 |
| 497 | 1117 | Q3MIE4|VAT1_RAT | 200.00 | 2 | 1 | 1 | N | 43119 |  |
 |
Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus OX=10116 GN=Vat1 PE=1 SV=1 |
| 524 | 23067 | tr|A0A8I6GA62|A0A8I6GA62_RAT | 200.00 | 18 | 6 | 6 | N | 44292 |  |
 |
NSFL1 cofactor p47 OS=Rattus norvegicus OX=10116 GN=Nsfl1c PE=1 SV=1 |
| 524 | 779 | O35987|NSF1C_RAT | 200.00 | 20 | 6 | 6 | N | 40680 | |
|
NSFL1 cofactor p47 OS=Rattus norvegicus OX=10116 GN=Nsfl1c PE=1 SV=1 |
| 524 | 23071 | tr|A0A0G2K911|A0A0G2K911_RAT | 200.00 | 20 | 6 | 6 | N | 40923 | |
|
NSFL1 cofactor p47 OS=Rattus norvegicus OX=10116 GN=Nsfl1c PE=1 SV=2 |
| 545 | 1817 | O08651|SERA_RAT | 200.00 | 17 | 7 | 7 | Y | 56493 |  |
 |
D-3-phosphoglycerate dehydrogenase OS=Rattus norvegicus OX=10116 GN=Phgdh PE=1 SV=3 |
| 553 | 22954 | tr|A0A8I6AK10|A0A8I6AK10_RAT | 200.00 | 11 | 3 | 3 | Y | 54550 |  |
 |
Fascin OS=Rattus norvegicus OX=10116 GN=Fscn1 PE=3 SV=1 |
| 558 | 26213 | tr|A0A8I6A5U6|A0A8I6A5U6_RAT | 200.00 | 18 | 4 | 4 | Y | 38611 |  |
 |
RNA-binding protein Luc7-like OS=Rattus norvegicus OX=10116 GN=Luc7l2 PE=1 SV=1 |
| 625 | 1348 | P61983|1433G_RAT | 200.00 | 6 | 1 | 1 | N | 28303 |  |
 |
14-3-3 protein gamma OS=Rattus norvegicus OX=10116 GN=Ywhag PE=1 SV=2 |
| 638 | 1978 | Q00981|UCHL1_RAT | 200.00 | 24 | 4 | 4 | Y | 24838 |  |
 |
Ubiquitin carboxyl-terminal hydrolase isozyme L1 OS=Rattus norvegicus OX=10116 GN=Uchl1 PE=1 SV=2 |
| 672 | 24837 | tr|A0A0G2K931|A0A0G2K931_RAT | 200.00 | 12 | 4 | 4 | N | 40599 |  |
 |
Phosphoserine aminotransferase OS=Rattus norvegicus OX=10116 GN=Psat1 PE=1 SV=2 |
| 696 | 3011 | Q5XI73|GDIR1_RAT | 200.00 | 7 | 2 | 2 | N | 23407 |  |
 |
Rho GDP-dissociation inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Arhgdia PE=1 SV=1 |
| 738 | 24940 | tr|A0A0G2K7K2|A0A0G2K7K2_RAT | 200.00 | 3 | 1 | 1 | Y | 66134 |  |
 |
Apoptosis inducing factor, mitochondria associated 1 OS=Rattus norvegicus OX=10116 GN=Aifm1 PE=1 SV=1 |
| 749 | 23865 | tr|A0A8I6AQI0|A0A8I6AQI0_RAT | 200.00 | 24 | 6 | 6 | Y | 54870 |  |
 |
RB binding protein 4, chromatin remodeling factor OS=Rattus norvegicus OX=10116 GN=Rbbp7 PE=1 SV=1 |
| 749 | 23927 | tr|A6ISI2|A6ISI2_RAT | 200.00 | 28 | 6 | 6 | Y | 47656 | |
|
RB binding protein 4, chromatin remodeling factor OS=Rattus norvegicus OX=10116 GN=Rbbp4 PE=1 SV=1 |
| 764 | 24115 | tr|A0A8I6A304|A0A8I6A304_RAT | 200.00 | 43 | 4 | 4 | N | 21817 |  |
|
Brain abundant, membrane attached signal protein 1 OS=Rattus norvegicus OX=10116 GN=Basp1 PE=1 SV=1 |
| 785 | 25173 | tr|A0A8I6APW4|A0A8I6APW4_RAT | 200.00 | 17 | 2 | 2 | Y | 11540 |  |
 |
Tubulin-specific chaperone A OS=Rattus norvegicus OX=10116 GN=Tbca PE=1 SV=1 |
| 785 | 25179 | tr|A0A8I5ZW23|A0A8I5ZW23_RAT | 200.00 | 9 | 2 | 2 | Y | 20522 | |
|
Tubulin-specific chaperone A OS=Rattus norvegicus OX=10116 GN=Tbca PE=1 SV=1 |
| 785 | 3858 | Q6PEC1|TBCA_RAT | 200.00 | 16 | 2 | 2 | Y | 12744 | |
|
Tubulin-specific chaperone A OS=Rattus norvegicus OX=10116 GN=Tbca PE=1 SV=1 |
| 785 | 25168 | tr|A0A8I6GCC1|A0A8I6GCC1_RAT | 200.00 | 20 | 2 | 2 | Y | 9969 | |
|
Tubulin-specific chaperone A OS=Rattus norvegicus OX=10116 GN=Tbca PE=1 SV=1 |
| 797 | 26696 | Q8CJB9|BRE1B_RAT | 200.00 | 2 | 1 | 1 | N | 113841 |  |
 |
E3 ubiquitin-protein ligase BRE1B OS=Rattus norvegicus OX=10116 GN=Rnf40 PE=1 SV=1 |
| 797 | 26697 | tr|A0A8L2UK73|A0A8L2UK73_RAT | 200.00 | 2 | 1 | 1 | N | 114290 | |
|
E3 ubiquitin protein ligase OS=Rattus norvegicus OX=10116 GN=Rnf40 PE=1 SV=1 |
| 806 | 23945 | tr|A0A8L2Q0Z9|A0A8L2Q0Z9_RAT | 200.00 | 11 | 2 | 2 | Y | 31101 |  |
 |
Dihydropteridine reductase OS=Rattus norvegicus OX=10116 GN=Qdpr PE=3 SV=1 |
| 806 | 2104 | P11348|DHPR_RAT | 200.00 | 13 | 2 | 2 | Y | 25552 | |
|
Dihydropteridine reductase OS=Rattus norvegicus OX=10116 GN=Qdpr PE=1 SV=1 |
| 816 | 1626 | O88989|MDHC_RAT | 200.00 | 22 | 5 | 5 | Y | 36483 |  |
 |
Malate dehydrogenase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Mdh1 PE=1 SV=3 |
| 816 | 23637 | tr|A0A8I6A721|A0A8I6A721_RAT | 200.00 | 21 | 5 | 5 | Y | 37131 | |
|
Malate dehydrogenase OS=Rattus norvegicus OX=10116 GN=Mdh1 PE=1 SV=1 |
| 828 | 25849 | tr|A0A8I5ZMN7|A0A8I5ZMN7_RAT | 200.00 | 3 | 1 | 1 | N | 45983 |  |
 |
Regulator of chromosome condensation OS=Rattus norvegicus OX=10116 GN=Rcc1 PE=1 SV=1 |
| 833 | 1422 | Q6Q0N1|CNDP2_RAT | 200.00 | 8 | 2 | 2 | N | 52693 |  |
 |
Cytosolic non-specific dipeptidase OS=Rattus norvegicus OX=10116 GN=Cndp2 PE=1 SV=1 |
| 838 | 25867 | tr|M0RBQ5|M0RBQ5_RAT | 200.00 | 8 | 2 | 2 | N | 13908 |  |
 |
Histone H2B OS=Rattus norvegicus OX=10116 GN=H2bu1 PE=3 SV=1 |
| 838 | 25866 | tr|D3ZNZ9|D3ZNZ9_RAT | 200.00 | 8 | 2 | 2 | N | 13994 | |
|
Histone H2B OS=Rattus norvegicus OX=10116 GN=Hist3h2ba PE=3 SV=1 |
| 843 | 1861 | P41565|IDHG1_RAT | 200.00 | 11 | 2 | 2 | Y | 42851 |  |
 |
Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Idh3g PE=1 SV=2 |
| 844 | 1873 | P54313|GBB2_RAT | 200.00 | 9 | 3 | 3 | Y | 37331 |  |
 |
Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Gnb2 PE=1 SV=4 |
| 870 | 25746 | tr|A0A0G2JVA2|A0A0G2JVA2_RAT | 200.00 | 19 | 4 | 4 | N | 35182 |  |
 |
Heterogeneous nuclear ribonucleoprotein H3 OS=Rattus norvegicus OX=10116 GN=Hnrnph3 PE=4 SV=1 |
| 895 | 1548 | Q99NA5|IDH3A_RAT | 200.00 | 19 | 5 | 5 | Y | 39614 |  |
|
Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Rattus norvegicus OX=10116 GN=Idh3a PE=1 SV=1 |
| 895 | 23645 | tr|F1LNF7|F1LNF7_RAT | 200.00 | 18 | 5 | 5 | Y | 41434 | |
|
Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Rattus norvegicus OX=10116 GN=Idh3a PE=3 SV=3 |
| 909 | 23691 | tr|A0A8I6AHS3|A0A8I6AHS3_RAT | 200.00 | 30 | 7 | 7 | Y | 46488 |  |
 |
Thioredoxin-like 1 OS=Rattus norvegicus OX=10116 GN=Txnl1 PE=1 SV=1 |
| 909 | 1780 | Q920J4|TXNL1_RAT | 200.00 | 43 | 7 | 7 | Y | 32249 | |
|
Thioredoxin-like protein 1 OS=Rattus norvegicus OX=10116 GN=Txnl1 PE=1 SV=3 |
| 909 | 23678 | tr|A0A8I5ZWH0|A0A8I5ZWH0_RAT | 200.00 | 44 | 7 | 7 | Y | 31588 | |
|
Thioredoxin-like 1 OS=Rattus norvegicus OX=10116 GN=Txnl1 PE=1 SV=1 |
| 909 | 23679 | tr|A0A0G2K737|A0A0G2K737_RAT | 200.00 | 43 | 7 | 7 | Y | 32700 | |
|
Thioredoxin-like 1 OS=Rattus norvegicus OX=10116 GN=Txnl1 PE=1 SV=1 |
| 944 | 24153 | tr|F7F067|F7F067_RAT | 200.00 | 11 | 2 | 2 | Y | 41312 |  |
 |
Actin related protein 1B OS=Rattus norvegicus OX=10116 GN=Actr1b PE=1 SV=1 |
| 947 | 24530 | tr|A0A0G2JZT5|A0A0G2JZT5_RAT | 200.00 | 4 | 1 | 1 | N | 46124 |  |
 |
Septin OS=Rattus norvegicus OX=10116 GN=Septin7 PE=1 SV=2 |
| 947 | 24537 | tr|A2VCW8|A2VCW8_RAT | 200.00 | 4 | 1 | 1 | N | 50679 | |
|
Septin OS=Rattus norvegicus OX=10116 GN=Septin7 PE=1 SV=1 |
| 947 | 3112 | Q9WVC0|SEPT7_RAT | 200.00 | 4 | 1 | 1 | N | 50508 | |
|
Septin-7 OS=Rattus norvegicus OX=10116 GN=Septin7 PE=1 SV=1 |
| 947 | 24531 | tr|F1LMC7|F1LMC7_RAT | 200.00 | 4 | 1 | 1 | N | 47522 | |
|
Septin OS=Rattus norvegicus OX=10116 GN=Septin7 PE=1 SV=4 |
| 963 | 2566 | Q7M0E3|DEST_RAT | 200.00 | 14 | 2 | 2 | Y | 18534 |  |
 |
Destrin OS=Rattus norvegicus OX=10116 GN=Dstn PE=1 SV=3 |
| 1202 | 24212 | tr|A0A0G2K7G7|A0A0G2K7G7_RAT | 200.00 | 4 | 1 | 1 | N | 55806 |  |
 |
Septin OS=Rattus norvegicus OX=10116 GN=Septin8 PE=1 SV=1 |
| 1202 | 24210 | tr|G3V9Z6|G3V9Z6_RAT | 200.00 | 5 | 1 | 1 | N | 49857 | |
|
Septin OS=Rattus norvegicus OX=10116 GN=Septin8 PE=1 SV=1 |
| 1202 | 24304 | tr|A0A0G2JVY6|A0A0G2JVY6_RAT | 200.00 | 4 | 1 | 1 | N | 55586 | |
|
Septin OS=Rattus norvegicus OX=10116 GN=Septin8 PE=1 SV=2 |
| 1202 | 24303 | tr|A0A8I6G6V9|A0A8I6G6V9_RAT | 200.00 | 4 | 1 | 1 | N | 52822 | |
|
Septin OS=Rattus norvegicus OX=10116 GN=Septin8 PE=1 SV=1 |
| 1219 | 27157 | tr|E9PU11|E9PU11_RAT | 200.00 | 3 | 1 | 1 | Y | 61848 |  |
 |
YTH domain-containing family protein OS=Rattus norvegicus OX=10116 GN=Ythdf2 PE=1 SV=4 |
| 1391 | 61217 | tr|A0A8I6G4I5|A0A8I6G4I5_RAT | 200.00 | 3 | 1 | 1 | N | 68696 |  |
 |
G-rich RNA sequence binding factor 1 OS=Rattus norvegicus OX=10116 GN=Grsf1 PE=1 SV=1 |
| 1393 | 4780 | Q32PX2|AIMP2_RAT | 200.00 | 3 | 1 | 1 | N | 35443 |  |
 |
Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 OS=Rattus norvegicus OX=10116 GN=Aimp2 PE=2 SV=1 |
| 1415 | 27159 | tr|A0A8I5ZWZ6|A0A8I5ZWZ6_RAT | 200.00 | 16 | 3 | 3 | Y | 27649 |  |
 |
Ribosome assembly factor mrt4 OS=Rattus norvegicus OX=10116 GN=Mrto4 PE=3 SV=1 |
| 1494 | 61085 | Q4FZT0|STML2_RAT | 200.00 | 11 | 2 | 2 | N | 38414 |  |
 |
Stomatin-like protein 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Stoml2 PE=1 SV=1 |
| 1593 | 25324 | tr|A6J9C6|A6J9C6_RAT | 200.00 | 12 | 1 | 1 | N | 22094 |  |
 |
Biliverdin reductase B OS=Rattus norvegicus OX=10116 GN=Blvrb PE=1 SV=1 |
| 1593 | 25325 | tr|A0A8I5ZUN1|A0A8I5ZUN1_RAT | 200.00 | 12 | 1 | 1 | N | 22994 | |
|
Biliverdin reductase B OS=Rattus norvegicus OX=10116 GN=Blvrb PE=1 SV=1 |
| 1883 | 26999 | tr|A0A8I6G7F4|A0A8I6G7F4_RAT | 200.00 | 30 | 3 | 3 | N | 13675 |  |
 |
Endosulfine alpha OS=Rattus norvegicus OX=10116 GN=Ensa PE=1 SV=1 |
| 1946 | 5056 | Q4QR85|MEP50_RAT | 200.00 | 4 | 1 | 1 | Y | 37076 |  |
 |
Methylosome protein WDR77 OS=Rattus norvegicus OX=10116 GN=Wdr77 PE=1 SV=1 |
| 2059 | 27720 | tr|Q5M920|Q5M920_RAT | 200.00 | 4 | 1 | 1 | N | 34745 |  |
 |
EBNA1 binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ebna1bp2 PE=1 SV=1 |
| 2067 | 6265 | Q9EPH2|MRP_RAT | 200.00 | 11 | 2 | 2 | N | 19847 |  |
 |
MARCKS-related protein OS=Rattus norvegicus OX=10116 GN=Marcksl1 PE=2 SV=3 |
| 2071 | 27446 | tr|D4A0E2|D4A0E2_RAT | 200.00 | 6 | 1 | 1 | N | 34101 |  |
 |
Gamma-soluble NSF attachment protein OS=Rattus norvegicus OX=10116 GN=Napg PE=3 SV=2 |
| 2130 | 6921 | Q498E0|TXD12_RAT | 200.00 | 9 | 1 | 1 | N | 19019 |  |
 |
Thioredoxin domain-containing protein 12 OS=Rattus norvegicus OX=10116 GN=Txndc12 PE=2 SV=2 |
| 2130 | 26691 | tr|A0A8L2Q4K2|A0A8L2Q4K2_RAT | 200.00 | 9 | 1 | 1 | N | 19523 | |
|
Thioredoxin domain-containing protein 12 OS=Rattus norvegicus OX=10116 GN=Txndc12 PE=1 SV=1 |
| 2879 | 43536 | D3ZCL3|RU1C_RAT | 200.00 | 19 | 2 | 2 | Y | 17364 |  |
 |
U1 small nuclear ribonucleoprotein C OS=Rattus norvegicus OX=10116 GN=Snrpc PE=3 SV=1 |
| 2879 | 43537 | tr|A0A8I6A3U2|A0A8I6A3U2_RAT | 200.00 | 19 | 2 | 2 | Y | 17391 | |
|
U1 small nuclear ribonucleoprotein C OS=Rattus norvegicus OX=10116 GN=Snrpc PE=1 SV=1 |
| 195 | 22934 | tr|A9CMB8|A9CMB8_RAT | 156.54 | 6 | 4 | 4 | Y | 92815 |  |
 |
DNA replication licensing factor MCM6 OS=Rattus norvegicus OX=10116 GN=Mcm6 PE=1 SV=1 |
| 266 | 477 | P04785|PDIA1_RAT | 156.54 | 25 | 11 | 11 | N | 56951 |  |
 |
Protein disulfide-isomerase OS=Rattus norvegicus OX=10116 GN=P4hb PE=1 SV=2 |
| 266 | 22871 | tr|A0A8I6A1R9|A0A8I6A1R9_RAT | 156.54 | 27 | 11 | 11 | N | 53948 | |
|
Protein disulfide-isomerase OS=Rattus norvegicus OX=10116 GN=P4hb PE=1 SV=1 |
| 2110 | 26917 | tr|B0K014|B0K014_RAT | 156.54 | 15 | 2 | 2 | N | 23394 |  |
 |
D-aminoacyl-tRNA deacylase OS=Rattus norvegicus OX=10116 GN=Dtd1 PE=1 SV=1 |
| 193 | 23490 | tr|Q4KM71|Q4KM71_RAT | 153.53 | 18 | 11 | 11 | N | 75487 |  |
 |
Splicing factor proline and glutamine rich OS=Rattus norvegicus OX=10116 GN=Sfpq PE=1 SV=1 |
| 448 | 23495 | tr|A0A8I6ALC1|A0A8I6ALC1_RAT | 153.53 | 16 | 5 | 5 | N | 38804 |  |
 |
Heterogeneous nuclear ribonucleoprotein A1 OS=Rattus norvegicus OX=10116 GN=Hnrnpa1 PE=4 SV=1 |
| 603 | 1264 | P04182|OAT_RAT | 153.53 | 17 | 5 | 5 | Y | 48333 |  |
 |
Ornithine aminotransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Oat PE=1 SV=1 |
| 2328 | 27369 | tr|A0A8I6GH88|A0A8I6GH88_RAT | 153.53 | 23 | 3 | 3 | Y | 17447 |  |
 |
peptidylprolyl isomerase OS=Rattus norvegicus OX=10116 GN=Fkbp2 PE=1 SV=1 |
| 2328 | 27368 | tr|D3ZZR9|D3ZZR9_RAT | 153.53 | 24 | 3 | 3 | Y | 17282 | |
|
peptidylprolyl isomerase OS=Rattus norvegicus OX=10116 GN=Fkbp2 PE=4 SV=2 |
| 3269 | 29009 | tr|A0A8I6G8H1|A0A8I6G8H1_RAT | 153.53 | 15 | 1 | 1 | Y | 8215 |  |
 |
Small nuclear ribonucleoprotein E OS=Rattus norvegicus OX=10116 GN=Snrpe PE=3 SV=1 |
| 3269 | 29010 | tr|D3ZSP1|D3ZSP1_RAT | 153.53 | 12 | 1 | 1 | Y | 10761 | |
|
Small nuclear ribonucleoprotein E OS=Rattus norvegicus OX=10116 GN=Snrpe PE=3 SV=1 |
| 3269 | 29011 | tr|D4A8M5|D4A8M5_RAT | 153.53 | 12 | 1 | 1 | Y | 10834 | |
|
Small nuclear ribonucleoprotein E OS=Rattus norvegicus OX=10116 GN=Snrpepl2 PE=3 SV=1 |
| 975 | 24376 | Q9ES54|NPL4_RAT | 150.51 | 8 | 2 | 2 | Y | 68056 |  |
 |
Nuclear protein localization protein 4 homolog OS=Rattus norvegicus OX=10116 GN=Nploc4 PE=1 SV=3 |
| 965 | 23898 | tr|A0A8L2QUA0|A0A8L2QUA0_RAT | 148.75 | 2 | 1 | 1 | N | 75871 |  |
 |
Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kifc1 PE=3 SV=1 |
| 965 | 2151 | Q5XI63|KIFC1_RAT | 148.75 | 2 | 1 | 1 | N | 76141 | |
|
Kinesin-like protein KIFC1 OS=Rattus norvegicus OX=10116 GN=Kifc1 PE=2 SV=1 |
| 2508 | 26883 | tr|A6KNE7|A6KNE7_RAT | 148.08 | 38 | 4 | 4 | N | 13282 |  |
 |
Small nuclear ribonucleoprotein Sm D1 OS=Rattus norvegicus OX=10116 GN=Snrpd1 PE=1 SV=1 |
| 997 | 2394 | Q66HG5|TM9S2_RAT | 147.50 | 5 | 2 | 2 | Y | 75586 |  |
 |
Transmembrane 9 superfamily member 2 OS=Rattus norvegicus OX=10116 GN=Tm9sf2 PE=2 SV=1 |
| 196 | 2567 | Q5FVM4|NONO_RAT | 146.54 | 15 | 7 | 7 | Y | 54925 |  |
 |
Non-POU domain-containing octamer-binding protein OS=Rattus norvegicus OX=10116 GN=Nono PE=1 SV=3 |
| 1120 | 42041 | tr|A0A0G2JZS1|A0A0G2JZS1_RAT | 146.12 | 4 | 1 | 1 | N | 59893 |  |
 |
Importin subunit alpha OS=Rattus norvegicus OX=10116 GN=Kpna6 PE=1 SV=1 |
| 1120 | 42042 | tr|F1LT58|F1LT58_RAT | 146.12 | 4 | 1 | 1 | N | 60366 | |
|
Importin subunit alpha OS=Rattus norvegicus OX=10116 GN=Kpna6 PE=1 SV=4 |
| 122 | 108 | Q9ER34|ACON_RAT | 145.07 | 16 | 7 | 7 | Y | 85433 |  |
 |
Aconitate hydratase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Aco2 PE=1 SV=2 |
| 122 | 22630 | tr|A0A8I6AIF6|A0A8I6AIF6_RAT | 145.07 | 17 | 7 | 7 | Y | 80127 | |
|
Aconitate hydratase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Aco2 PE=1 SV=1 |
| 122 | 22640 | tr|A0A8I5ZLT6|A0A8I5ZLT6_RAT | 145.07 | 16 | 7 | 7 | Y | 85141 | |
|
Aconitate hydratase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Aco2 PE=1 SV=1 |
| 442 | 947 | Q5RKI1|IF4A2_RAT | 143.11 | 4 | 1 | 1 | N | 46402 |  |
 |
Eukaryotic initiation factor 4A-II OS=Rattus norvegicus OX=10116 GN=Eif4a2 PE=1 SV=1 |
| 1755 | 25417 | tr|A0A8I6AII6|A0A8I6AII6_RAT | 142.73 | 9 | 1 | 1 | N | 23469 |  |
 |
small monomeric GTPase OS=Rattus norvegicus OX=10116 GN=Rab5b PE=1 SV=1 |
| 1755 | 25418 | tr|A1L1J8|A1L1J8_RAT | 142.73 | 9 | 1 | 1 | N | 23675 | |
|
small monomeric GTPase OS=Rattus norvegicus OX=10116 GN=Rab5b PE=3 SV=1 |
| 235 | 1043 | P04905|GSTM1_RAT | 142.06 | 6 | 1 | 1 | N | 25914 |  |
|
Glutathione S-transferase Mu 1 OS=Rattus norvegicus OX=10116 GN=Gstm1 PE=1 SV=2 |
| 1317 | 26628 | tr|D4A720|D4A720_RAT | 140.51 | 8 | 2 | 2 | Y | 26023 |  |
 |
Serine and arginine rich splicing factor 7 OS=Rattus norvegicus OX=10116 GN=Srsf7 PE=1 SV=2 |
| 1317 | 26629 | tr|A0A8I6GMN8|A0A8I6GMN8_RAT | 140.51 | 8 | 2 | 2 | Y | 27154 | |
|
Serine and arginine rich splicing factor 7 OS=Rattus norvegicus OX=10116 GN=Srsf7 PE=1 SV=1 |
| 1317 | 26630 | tr|A0A8I6AFZ5|A0A8I6AFZ5_RAT | 140.51 | 8 | 2 | 2 | Y | 27378 | |
|
Serine and arginine rich splicing factor 7 OS=Rattus norvegicus OX=10116 GN=Srsf7 PE=3 SV=1 |
| 1317 | 26627 | tr|A0A8I6ALL8|A0A8I6ALL8_RAT | 140.51 | 8 | 2 | 2 | Y | 24955 | |
|
Serine and arginine rich splicing factor 7 OS=Rattus norvegicus OX=10116 GN=Srsf7 PE=1 SV=1 |
| 216 | 23046 | tr|A0A8I6A206|A0A8I6A206_RAT | 140.30 | 14 | 11 | 11 | N | 77095 |  |
 |
Nucleolin OS=Rattus norvegicus OX=10116 GN=Ncl PE=1 SV=1 |
| 216 | 23051 | tr|A0A8I5Y747|A0A8I5Y747_RAT | 140.30 | 13 | 11 | 11 | N | 81008 | |
|
Nucleolin OS=Rattus norvegicus OX=10116 GN=Ncl PE=1 SV=1 |
| 2144 | 27255 | P55770|NH2L1_RAT | 137.19 | 34 | 5 | 5 | Y | 14174 |  |
 |
NHP2-like protein 1 OS=Rattus norvegicus OX=10116 GN=Snu13 PE=2 SV=4 |
| 1829 | 25301 | tr|G3V7J2|G3V7J2_RAT | 136.71 | 10 | 2 | 2 | Y | 34385 |  |
 |
Protein activator of interferon induced protein kinase EIF2AK2 OS=Rattus norvegicus OX=10116 GN=Prkra PE=1 SV=1 |
| 774 | 26155 | tr|A0A0G2K435|A0A0G2K435_RAT | 135.17 | 7 | 3 | 3 | Y | 65528 |  |
 |
DnaJ heat shock protein family (Hsp40) member C7 OS=Rattus norvegicus OX=10116 GN=Dnajc7 PE=1 SV=1 |
| 774 | 26154 | tr|G3V8B8|G3V8B8_RAT | 135.17 | 9 | 3 | 3 | Y | 55045 | |
|
DnaJ heat shock protein family (Hsp40) member C7 OS=Rattus norvegicus OX=10116 GN=Dnajc7 PE=4 SV=3 |
| 620 | 764 | Q9Z2L0|VDAC1_RAT | 134.66 | 25 | 6 | 6 | Y | 30756 |  |
 |
Non-selective voltage-gated ion channel VDAC1 OS=Rattus norvegicus OX=10116 GN=Vdac1 PE=1 SV=4 |
| 1380 | 3214 | Q6RUV5|RAC1_RAT | 133.57 | 15 | 2 | 2 | Y | 21450 |  |
 |
Ras-related C3 botulinum toxin substrate 1 OS=Rattus norvegicus OX=10116 GN=Rac1 PE=1 SV=1 |
| 1380 | 24736 | tr|A0A0U1RS21|A0A0U1RS21_RAT | 133.57 | 13 | 2 | 2 | Y | 23436 | |
|
Ras-related C3 botulinum toxin substrate 1 OS=Rattus norvegicus OX=10116 GN=Rac1 PE=3 SV=2 |
| 1725 | 2847 | M0RC99|RAB5A_RAT | 133.09 | 24 | 2 | 2 | Y | 23625 |  |
 |
Ras-related protein Rab-5A OS=Rattus norvegicus OX=10116 GN=Rab5a PE=2 SV=1 |
| 1725 | 24517 | tr|A0A8I5ZS76|A0A8I5ZS76_RAT | 133.09 | 24 | 2 | 2 | Y | 23615 | |
|
small monomeric GTPase OS=Rattus norvegicus OX=10116 GN=Rab5a PE=1 SV=1 |
| 1048 | 2538 | P15791|KCC2D_RAT | 132.57 | 3 | 1 | 1 | N | 60081 |  |
 |
Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus OX=10116 GN=Camk2d PE=1 SV=1 |
| 1048 | 24185 | tr|A0A8I6A550|A0A8I6A550_RAT | 132.57 | 3 | 1 | 1 | N | 57826 | |
|
calcium/calmodulin-dependent protein kinase OS=Rattus norvegicus OX=10116 GN=Camk2d PE=1 SV=1 |
| 2814 | 42424 | Q5BJX0|NTM1A_RAT | 132.29 | 10 | 2 | 2 | Y | 25464 |  |
 |
N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ntmt1 PE=2 SV=3 |
| 1182 | 5822 | P63164|RSMN_RAT | 130.83 | 15 | 4 | 4 | Y | 24614 |  |
 |
Small nuclear ribonucleoprotein-associated protein N OS=Rattus norvegicus OX=10116 GN=Snrpn PE=1 SV=1 |
| 1182 | 5987 | P17136|RSMB_RAT | 130.83 | 16 | 4 | 4 | Y | 23656 | |
|
Small nuclear ribonucleoprotein-associated protein B OS=Rattus norvegicus OX=10116 GN=Snrpb PE=2 SV=2 |
| 1182 | 26518 | tr|A0A8I6GLH2|A0A8I6GLH2_RAT | 130.83 | 16 | 4 | 4 | Y | 23312 | |
|
Small nuclear ribonucleoprotein-associated protein OS=Rattus norvegicus OX=10116 GN=Snrpb PE=3 SV=1 |
| 569 | 23348 | tr|A0A0G2K3Z9|A0A0G2K3Z9_RAT | 130.48 | 38 | 8 | 8 | N | 22164 |  |
 |
Peroxiredoxin-1 OS=Rattus norvegicus OX=10116 GN=Prdx1l1 PE=3 SV=1 |
| 569 | 1098 | Q63716|PRDX1_RAT | 130.48 | 38 | 8 | 8 | N | 22109 | |
|
Peroxiredoxin-1 OS=Rattus norvegicus OX=10116 GN=Prdx1 PE=1 SV=1 |
| 1011 | 2999 | Q9Z0V5|PRDX4_RAT | 130.02 | 26 | 4 | 4 | Y | 31007 |  |
 |
Peroxiredoxin-4 OS=Rattus norvegicus OX=10116 GN=Prdx4 PE=2 SV=1 |
| 1011 | 24478 | tr|A0A8I6AL33|A0A8I6AL33_RAT | 130.02 | 28 | 4 | 4 | Y | 28476 | |
|
thioredoxin-dependent peroxiredoxin OS=Rattus norvegicus OX=10116 GN=Prdx4 PE=1 SV=1 |
| 1465 | 24472 | tr|F1M978|F1M978_RAT | 129.31 | 3 | 1 | 1 | N | 36278 |  |
 |
Inositol-1-monophosphatase OS=Rattus norvegicus OX=10116 GN=Impa1 PE=1 SV=2 |
| 991 | 25545 | tr|A0A8I5YBK1|A0A8I5YBK1_RAT | 128.42 | 9 | 3 | 3 | Y | 49251 |  |
 |
Histone acetyltransferase type B catalytic subunit OS=Rattus norvegicus OX=10116 GN=Hat1 PE=1 SV=1 |
| 991 | 25546 | tr|A0A8I5ZN33|A0A8I5ZN33_RAT | 128.42 | 8 | 3 | 3 | Y | 51239 | |
|
Histone acetyltransferase type B catalytic subunit OS=Rattus norvegicus OX=10116 GN=Hat1 PE=1 SV=1 |
| 991 | 4626 | Q5M939|HAT1_RAT | 128.42 | 9 | 3 | 3 | Y | 49241 | |
|
Histone acetyltransferase type B catalytic subunit OS=Rattus norvegicus OX=10116 GN=Hat1 PE=2 SV=1 |
| 925 | 23821 | tr|A0A8I5ZQN0|A0A8I5ZQN0_RAT | 128.10 | 10 | 2 | 2 | N | 30002 |  |
 |
Phosphatidylethanolamine binding protein 1 OS=Rattus norvegicus OX=10116 GN=Pebp1 PE=1 SV=1 |
| 925 | 1791 | P31044|PEBP1_RAT | 128.10 | 14 | 2 | 2 | N | 20801 | |
|
Phosphatidylethanolamine-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Pebp1 PE=1 SV=3 |
| 1697 | 26985 | P70550|RAB8B_RAT | 125.81 | 6 | 1 | 1 | N | 23603 |  |
 |
Ras-related protein Rab-8B OS=Rattus norvegicus OX=10116 GN=Rab8b PE=1 SV=1 |
| 136 | 178 | Q4QRB4|TBB3_RAT | 124.65 | 9 | 2 | 2 | N | 50419 |  |
 |
Tubulin beta-3 chain OS=Rattus norvegicus OX=10116 GN=Tubb3 PE=1 SV=1 |
| 1190 | 4474 | Q6PEC4|SKP1_RAT | 124.07 | 26 | 4 | 4 | N | 18672 |  |
 |
S-phase kinase-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Skp1 PE=1 SV=3 |
| 1190 | 25617 | tr|A0A0G2K4X8|A0A0G2K4X8_RAT | 124.07 | 26 | 4 | 4 | N | 18931 | |
|
S-phase kinase-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Skp1 PE=1 SV=1 |
| 610 | 2264 | P22509|FBRL_RAT | 123.60 | 27 | 7 | 7 | N | 34222 |  |
 |
rRNA 2'-O-methyltransferase fibrillarin OS=Rattus norvegicus OX=10116 GN=Fbl PE=1 SV=2 |
| 610 | 24094 | tr|A0A8L2UK98|A0A8L2UK98_RAT | 123.60 | 27 | 7 | 7 | N | 34564 | |
|
Fibrillarin OS=Rattus norvegicus OX=10116 GN=Fbl PE=1 SV=1 |
| 673 | 1486 | P84092|AP2M1_RAT | 121.20 | 21 | 6 | 6 | Y | 49655 |  |
 |
AP-2 complex subunit mu OS=Rattus norvegicus OX=10116 GN=Ap2m1 PE=1 SV=1 |
| 673 | 23517 | tr|A0A140TAH5|A0A140TAH5_RAT | 121.20 | 21 | 6 | 6 | Y | 49389 | |
|
AP-2 complex subunit mu OS=Rattus norvegicus OX=10116 GN=Ap2m1 PE=1 SV=2 |
| 1536 | 61033 | tr|A0A0G2JXS2|A0A0G2JXS2_RAT | 121.04 | 2 | 1 | 1 | Y | 81317 |  |
 |
Protein KRI1 homolog OS=Rattus norvegicus OX=10116 GN=Kri1 PE=3 SV=2 |
| 435 | 24876 | tr|Q4KLK7|Q4KLK7_RAT | 118.78 | 8 | 4 | 4 | Y | 65400 |  |
 |
Nucleolar protein 56 OS=Rattus norvegicus OX=10116 GN=Nop56 PE=1 SV=1 |
| 234 | 523 | P00388|NCPR_RAT | 117.99 | 7 | 3 | 3 | Y | 76963 |  |
 |
NADPH--cytochrome P450 reductase OS=Rattus norvegicus OX=10116 GN=Por PE=1 SV=3 |
| 234 | 22880 | tr|A0A8L2Q089|A0A8L2Q089_RAT | 117.99 | 7 | 3 | 3 | Y | 77613 | |
|
NADPH--cytochrome P450 reductase OS=Rattus norvegicus OX=10116 GN=Por PE=1 SV=1 |
| 505 | 23834 | tr|F1LVV4|F1LVV4_RAT | 117.49 | 15 | 5 | 5 | Y | 56027 |  |
 |
Regulator of chromosome condensation 2 OS=Rattus norvegicus OX=10116 GN=Rcc2 PE=1 SV=2 |
| 1344 | 4294 | Q6AYP5|CADM1_RAT | 116.48 | 8 | 2 | 2 | Y | 51854 |  |
 |
Cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Cadm1 PE=1 SV=1 |
| 1344 | 25503 | tr|A0A0G2JUT1|A0A0G2JUT1_RAT | 116.48 | 9 | 2 | 2 | Y | 45742 | |
|
Cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Cadm1 PE=1 SV=2 |
| 1344 | 25504 | tr|A0A8I6GLS0|A0A8I6GLS0_RAT | 116.48 | 8 | 2 | 2 | Y | 48766 | |
|
Cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Cadm1 PE=1 SV=1 |
| 1344 | 25505 | tr|A0A5H1ZRU4|A0A5H1ZRU4_RAT | 116.48 | 8 | 2 | 2 | Y | 49954 | |
|
Cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Cadm1 PE=3 SV=2 |
| 162 | 22962 | tr|A0A0G2JZ56|A0A0G2JZ56_RAT | 116.02 | 0 | 1 | 1 | N | 439215 |  |
 |
Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2 |
| 162 | 22961 | tr|A0A0G2K6R9|A0A0G2K6R9_RAT | 116.02 | 0 | 1 | 1 | N | 437139 | |
|
Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2 |
| 162 | 22960 | tr|F1M9N9|F1M9N9_RAT | 116.02 | 0 | 1 | 1 | N | 434779 | |
|
Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=4 |
| 1200 | 3263 | Q6TUG0|DJB11_RAT | 115.74 | 8 | 2 | 2 | Y | 40495 |  |
 |
DnaJ homolog subfamily B member 11 OS=Rattus norvegicus OX=10116 GN=Dnajb11 PE=2 SV=1 |
| 1200 | 24881 | tr|A0A8I6GBN9|A0A8I6GBN9_RAT | 115.74 | 8 | 2 | 2 | Y | 38378 | |
|
DnaJ homolog subfamily B member 11 OS=Rattus norvegicus OX=10116 GN=Dnajb11 PE=1 SV=1 |
| 1200 | 24882 | tr|A0A8I6AD26|A0A8I6AD26_RAT | 115.74 | 8 | 2 | 2 | Y | 39697 | |
|
DnaJ homolog subfamily B member 11 OS=Rattus norvegicus OX=10116 GN=Dnajb11 PE=1 SV=1 |
| 710 | 3575 | Q9JJ54|HNRPD_RAT | 113.13 | 15 | 4 | 4 | Y | 38218 |  |
 |
Heterogeneous nuclear ribonucleoprotein D0 OS=Rattus norvegicus OX=10116 GN=Hnrnpd PE=1 SV=2 |
| 450 | 626 | P63004|LIS1_RAT | 112.33 | 25 | 7 | 7 | Y | 46670 |  |
 |
Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus OX=10116 GN=Pafah1b1 PE=1 SV=2 |
| 1683 | 29552 | tr|D4A8M7|D4A8M7_RAT | 112.29 | 3 | 1 | 1 | Y | 82135 |  |
 |
Condensin complex subunit 2 OS=Rattus norvegicus OX=10116 GN=Ncaph PE=1 SV=3 |
| 1683 | 42056 | tr|A0A8I5ZVL6|A0A8I5ZVL6_RAT | 112.29 | 3 | 1 | 1 | Y | 82040 | |
|
Condensin complex subunit 2 OS=Rattus norvegicus OX=10116 GN=Ncaph PE=1 SV=1 |
| 1893 | 61071 | tr|A0A8I6AIR3|A0A8I6AIR3_RAT | 110.97 | 4 | 1 | 1 | N | 46443 |  |
 |
non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Vrk1 PE=1 SV=1 |
| 1893 | 61072 | tr|A0A8I6GA19|A0A8I6GA19_RAT | 110.97 | 4 | 1 | 1 | N | 47436 | |
|
non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Vrk1 PE=1 SV=1 |
| 1893 | 61073 | tr|A0A8I5XW39|A0A8I5XW39_RAT | 110.97 | 3 | 1 | 1 | N | 49793 | |
|
non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Vrk1 PE=1 SV=1 |
| 723 | 3469 | P0DP31|CALM3_RAT | 110.73 | 52 | 7 | 7 | Y | 16838 |  |
 |
Calmodulin-3 OS=Rattus norvegicus OX=10116 GN=Calm3 PE=1 SV=1 |
| 723 | 24995 | P0DP30|CALM2_RAT | 110.73 | 52 | 7 | 7 | Y | 16838 | |
|
Calmodulin-2 OS=Rattus norvegicus OX=10116 GN=Calm2 PE=1 SV=1 |
| 723 | 24996 | P0DP29|CALM1_RAT | 110.73 | 52 | 7 | 7 | Y | 16838 | |
|
Calmodulin-1 OS=Rattus norvegicus OX=10116 GN=Calm1 PE=1 SV=1 |
| 1765 | 61607 | tr|D3ZQV8|D3ZQV8_RAT | 108.64 | 4 | 1 | 1 | Y | 41097 |  |
 |
PHD finger protein 6 OS=Rattus norvegicus OX=10116 GN=Phf6 PE=1 SV=1 |
| 1111 | 2990 | Q8K1Q0|NMT1_RAT | 107.48 | 4 | 1 | 1 | N | 56860 |  |
 |
Glycylpeptide N-tetradecanoyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Nmt1 PE=1 SV=1 |
| 1111 | 24565 | tr|A0A8I6ATE4|A0A8I6ATE4_RAT | 107.48 | 4 | 1 | 1 | N | 57227 | |
|
Glycylpeptide N-tetradecanoyltransferase OS=Rattus norvegicus OX=10116 GN=Nmt1 PE=1 SV=1 |
| 2563 | 42285 | tr|D4A5T1|D4A5T1_RAT | 106.66 | 10 | 1 | 1 | N | 10119 |  |
 |
Splicing factor 3B subunit 5 OS=Rattus norvegicus OX=10116 GN=Sf3b5 PE=3 SV=1 |
| 2716 | 28583 | tr|A6ISV1|A6ISV1_RAT | 105.69 | 7 | 1 | 1 | N | 38540 |  |
 |
Protein phosphatase 1, regulatory (Inhibitor) subunit 8 OS=Rattus norvegicus OX=10116 GN=Ppp1r8 PE=1 SV=1 |
| 734 | 3334 | Q3T1J1|IF5A1_RAT | 105.68 | 11 | 3 | 3 | N | 16832 |  |
 |
Eukaryotic translation initiation factor 5A-1 OS=Rattus norvegicus OX=10116 GN=Eif5a PE=1 SV=3 |
| 734 | 24892 | tr|A0A8L2QBS3|A0A8L2QBS3_RAT | 105.68 | 10 | 3 | 3 | N | 17986 | |
|
Eukaryotic translation initiation factor 5A OS=Rattus norvegicus OX=10116 GN=Eif5a PE=1 SV=1 |
| 142 | 23320 | tr|D3ZP96|D3ZP96_RAT | 104.76 | 20 | 13 | 13 | Y | 102143 |  |
 |
DNA replication licensing factor MCM2 OS=Rattus norvegicus OX=10116 GN=Mcm2 PE=1 SV=2 |
| 1314 | 11798 | O35095|NCDN_RAT | 103.49 | 2 | 1 | 1 | N | 78923 |  |
 |
Neurochondrin OS=Rattus norvegicus OX=10116 GN=Ncdn PE=1 SV=2 |
| 1813 | 30022 | tr|A0A8I6AND0|A0A8I6AND0_RAT | 103.02 | 3 | 2 | 2 | N | 85818 |  |
 |
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Rattus norvegicus OX=10116 GN=Stt3a PE=1 SV=1 |
| 1813 | 30018 | tr|A0A8J8YL51|A0A8J8YL51_RAT | 103.02 | 3 | 2 | 2 | N | 80083 | |
|
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Rattus norvegicus OX=10116 GN=Stt3a PE=1 SV=1 |
| 2199 | 61021 | tr|M0RDD7|M0RDD7_RAT | 100.27 | 10 | 1 | 1 | N | 22881 |  |
 |
Chromatin target of PRMT1-like 1 OS=Rattus norvegicus OX=10116 GN=Chtopl1 PE=4 SV=2 |
| 832 | 41949 | Q63692|CDC37_RAT | 99.61 | 7 | 2 | 2 | N | 44510 |  |
 |
Hsp90 co-chaperone Cdc37 OS=Rattus norvegicus OX=10116 GN=Cdc37 PE=1 SV=2 |
| 1866 | 30046 | tr|M0R9D4|M0R9D4_RAT | 98.58 | 7 | 2 | 2 | N | 21707 |  |
 |
High mobility group box 3 OS=Rattus norvegicus OX=10116 GN=Hmgb3 PE=1 SV=1 |
| 1866 | 30047 | tr|A0A0G2JVF5|A0A0G2JVF5_RAT | 98.58 | 7 | 2 | 2 | N | 23501 | |
|
High mobility group box 3 OS=Rattus norvegicus OX=10116 GN=Hmgb3 PE=1 SV=1 |
| 960 | 27929 | tr|A0A8L2ULJ1|A0A8L2ULJ1_RAT | 98.21 | 2 | 1 | 1 | N | 83445 |  |
 |
Elongation factor G, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gfm1 PE=1 SV=1 |
| 888 | 24801 | tr|F1M7B8|F1M7B8_RAT | 97.38 | 2 | 1 | 1 | Y | 99753 |  |
 |
Ubiquitin-protein ligase E3A OS=Rattus norvegicus OX=10116 GN=Ube3a PE=1 SV=2 |
| 888 | 24800 | tr|A0A8I5ZM14|A0A8I5ZM14_RAT | 97.38 | 2 | 1 | 1 | Y | 100092 | |
|
Ubiquitin-protein ligase E3A OS=Rattus norvegicus OX=10116 GN=Ube3a PE=1 SV=1 |
| 551 | 1704 | O89049|TRXR1_RAT | 97.23 | 12 | 4 | 4 | Y | 54671 |  |
 |
Thioredoxin reductase 1, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Txnrd1 PE=1 SV=5 |
| 551 | 23625 | tr|R9PXU4|R9PXU4_RAT | 97.23 | 12 | 4 | 4 | Y | 54610 | |
|
Thioredoxin reductase 1, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Txnrd1 PE=1 SV=3 |
| 1053 | 2796 | Q8CGS5|RNZ2_RAT | 96.82 | 1 | 1 | 1 | Y | 92340 |  |
 |
Zinc phosphodiesterase ELAC protein 2 OS=Rattus norvegicus OX=10116 GN=Elac2 PE=1 SV=1 |
| 1053 | 24432 | tr|A0A8I6A3T7|A0A8I6A3T7_RAT | 96.82 | 1 | 1 | 1 | Y | 91895 | |
|
Zinc phosphodiesterase ELAC protein 2 OS=Rattus norvegicus OX=10116 GN=Elac2 PE=1 SV=1 |
| 1053 | 24433 | tr|G3V6F5|G3V6F5_RAT | 96.82 | 1 | 1 | 1 | Y | 92331 | |
|
Zinc phosphodiesterase ELAC protein 2 OS=Rattus norvegicus OX=10116 GN=Elac2 PE=1 SV=1 |
| 1053 | 24434 | tr|A0A8I6AHK2|A0A8I6AHK2_RAT | 96.82 | 1 | 1 | 1 | Y | 93090 | |
|
Zinc phosphodiesterase ELAC protein 2 OS=Rattus norvegicus OX=10116 GN=Elac2 PE=1 SV=1 |
| 386 | 1684 | Q9QZ86|NOP58_RAT | 96.46 | 18 | 7 | 7 | Y | 60071 |  |
 |
Nucleolar protein 58 OS=Rattus norvegicus OX=10116 GN=Nop58 PE=1 SV=1 |
| 386 | 23692 | tr|A0A8I5ZV87|A0A8I5ZV87_RAT | 96.46 | 18 | 7 | 7 | Y | 59810 | |
|
NOP58 ribonucleoprotein OS=Rattus norvegicus OX=10116 GN=Nop58 PE=1 SV=1 |
| 1824 | 28147 | Q6AXQ5|PDE12_RAT | 96.20 | 3 | 1 | 1 | N | 67176 |  |
 |
2',5'-phosphodiesterase 12 OS=Rattus norvegicus OX=10116 GN=Pde12 PE=2 SV=1 |
| 287 | 1026 | Q3B8Q2|IF4A3_RAT | 95.82 | 4 | 2 | 2 | N | 46841 |  |
 |
Eukaryotic initiation factor 4A-III OS=Rattus norvegicus OX=10116 GN=Eif4a3 PE=1 SV=1 |
| 18 | 22615 | tr|A0A8I6AGZ0|A0A8I6AGZ0_RAT | 95.63 | 37 | 43 | 43 | Y | 189019 |  |
 |
Clathrin heavy chain OS=Rattus norvegicus OX=10116 GN=Cltc PE=1 SV=1 |
| 556 | 23494 | tr|A0A8I6AGF5|A0A8I6AGF5_RAT | 95.27 | 5 | 2 | 2 | N | 71283 |  |
 |
Sec1 family domain containing 1 OS=Rattus norvegicus OX=10116 GN=Scfd1 PE=1 SV=1 |
| 556 | 1634 | Q62991|SCFD1_RAT | 95.27 | 5 | 2 | 2 | N | 72263 | |
|
Sec1 family domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Scfd1 PE=1 SV=1 |
| 2490 | 5694 | Q9WU49|CHSP1_RAT | 95.18 | 35 | 2 | 2 | N | 15906 |  |
 |
Calcium-regulated heat stable protein 1 OS=Rattus norvegicus OX=10116 GN=Carhsp1 PE=1 SV=1 |
| 2555 | 26948 | tr|D4AAT4|D4AAT4_RAT | 94.63 | 49 | 3 | 3 | Y | 9725 |  |
 |
Sm protein F OS=Rattus norvegicus OX=10116 GN=Snrpf PE=3 SV=1 |
| 2461 | 30110 | tr|G3V678|G3V678_RAT | 94.54 | 19 | 2 | 2 | N | 17143 |  |
 |
DNA-directed RNA polymerases I, II, and III subunit RPABC3 OS=Rattus norvegicus OX=10116 GN=Polr2h PE=1 SV=1 |
| 476 | 42020 | tr|A0A0G2K762|A0A0G2K762_RAT | 94.30 | 8 | 4 | 4 | N | 71128 |  |
 |
ATP binding cassette subfamily F member 2 OS=Rattus norvegicus OX=10116 GN=Abcf2 PE=1 SV=1 |
| 1750 | 4243 | O35263|PA1B3_RAT | 94.18 | 4 | 1 | 1 | N | 25863 |  |
 |
Platelet-activating factor acetylhydrolase IB subunit alpha1 OS=Rattus norvegicus OX=10116 GN=Pafah1b3 PE=1 SV=1 |
| 2180 | 26207 | tr|A0A8I6A2B3|A0A8I6A2B3_RAT | 94.03 | 5 | 1 | 1 | Y | 29295 |  |
 |
guanylate kinase OS=Rattus norvegicus OX=10116 GN=Guk1 PE=1 SV=1 |
| 2180 | 26206 | tr|E9PTV0|E9PTV0_RAT | 94.03 | 6 | 1 | 1 | Y | 22835 | |
|
guanylate kinase OS=Rattus norvegicus OX=10116 GN=Guk1 PE=3 SV=3 |
| 1770 | 25810 | tr|D3ZUB0|D3ZUB0_RAT | 93.79 | 14 | 2 | 2 | N | 38090 |  |
 |
Reticulocalbin 1 OS=Rattus norvegicus OX=10116 GN=Rcn1 PE=3 SV=1 |
| 406 | 23183 | tr|A0A8I5ZUU4|A0A8I5ZUU4_RAT | 93.72 | 4 | 2 | 2 | Y | 56733 |  |
 |
Ataxin-10 OS=Rattus norvegicus OX=10116 GN=Atxn10 PE=1 SV=1 |
| 406 | 972 | Q9ER24|ATX10_RAT | 93.72 | 4 | 2 | 2 | Y | 53727 | |
|
Ataxin-10 OS=Rattus norvegicus OX=10116 GN=Atxn10 PE=1 SV=1 |
| 406 | 23185 | tr|A0A8L2QB12|A0A8L2QB12_RAT | 93.72 | 4 | 2 | 2 | Y | 53444 | |
|
Ataxin-10 OS=Rattus norvegicus OX=10116 GN=Atxn10 PE=1 SV=1 |
| 440 | 23101 | tr|G3V9Q3|G3V9Q3_RAT | 93.39 | 20 | 5 | 5 | Y | 48265 |  |
 |
Heterogeneous nuclear ribonucleoprotein H1 OS=Rattus norvegicus OX=10116 GN=Hnrnph1 PE=1 SV=3 |
| 440 | 23102 | tr|A0A8I6G5X8|A0A8I6G5X8_RAT | 93.39 | 18 | 5 | 5 | Y | 51191 | |
|
Heterogeneous nuclear ribonucleoprotein H1 OS=Rattus norvegicus OX=10116 GN=Hnrnph1 PE=1 SV=1 |
| 245 | 23573 | tr|B2GUX3|B2GUX3_RAT | 92.97 | 12 | 6 | 6 | Y | 82466 |  |
 |
DNA replication licensing factor MCM5 OS=Rattus norvegicus OX=10116 GN=Mcm5 PE=1 SV=1 |
| 1808 | 26377 | tr|A0A8I6AUY1|A0A8I6AUY1_RAT | 92.55 | 7 | 2 | 2 | N | 56748 |  |
 |
Luc7-like protein OS=Rattus norvegicus OX=10116 GN=Luc7l3 PE=1 SV=1 |
| 1808 | 26378 | tr|D3ZFB2|D3ZFB2_RAT | 92.55 | 7 | 2 | 2 | N | 58424 | |
|
Luc7-like protein OS=Rattus norvegicus OX=10116 GN=Luc7l3 PE=1 SV=1 |
| 1808 | 26376 | tr|A0A8I6AE53|A0A8I6AE53_RAT | 92.55 | 7 | 2 | 2 | N | 55570 | |
|
Luc7-like protein OS=Rattus norvegicus OX=10116 GN=Luc7l3 PE=1 SV=1 |
| 1808 | 26427 | tr|A0A8I5ZVZ0|A0A8I5ZVZ0_RAT | 92.55 | 7 | 2 | 2 | N | 56960 | |
|
Luc7-like protein OS=Rattus norvegicus OX=10116 GN=Luc7l3 PE=1 SV=1 |
| 252 | 23091 | tr|F7ELS2|F7ELS2_RAT | 92.38 | 5 | 3 | 3 | N | 61744 |  |
 |
T-complex protein 1 subunit zeta OS=Rattus norvegicus OX=10116 GN=Cct6a PE=1 SV=1 |
| 27 | 22646 | tr|G3V7Q7|G3V7Q7_RAT | 92.07 | 11 | 13 | 13 | N | 188831 |  |
 |
IQ motif containing GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Iqgap1 PE=1 SV=1 |
| 680 | 24002 | tr|A0A8L2QDA9|A0A8L2QDA9_RAT | 91.94 | 1 | 1 | 1 | N | 72444 |  |
 |
5'-nucleotidase domain containing 2 OS=Rattus norvegicus OX=10116 GN=Nt5dc2 PE=3 SV=1 |
| 680 | 2119 | Q6Q0N3|NT5D2_RAT | 91.94 | 2 | 1 | 1 | N | 63653 | |
|
5'-nucleotidase domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Nt5dc2 PE=2 SV=2 |
| 952 | 5679 | P63036|DNJA1_RAT | 91.90 | 31 | 7 | 7 | Y | 44868 |  |
 |
DnaJ homolog subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Dnaja1 PE=1 SV=1 |
| 117 | 513 | P27653|C1TC_RAT | 91.48 | 6 | 5 | 5 | N | 100996 |  |
 |
C-1-tetrahydrofolate synthase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Mthfd1 PE=1 SV=3 |
| 1068 | 24910 | tr|A0A8I6AJA8|A0A8I6AJA8_RAT | 91.44 | 8 | 3 | 3 | Y | 62499 |  |
 |
Translation initiation factor eIF2B subunit delta OS=Rattus norvegicus OX=10116 GN=Eif2b4 PE=1 SV=1 |
| 1068 | 3814 | Q63186|EI2BD_RAT | 91.44 | 9 | 3 | 3 | Y | 57809 | |
|
Translation initiation factor eIF2B subunit delta OS=Rattus norvegicus OX=10116 GN=Eif2b4 PE=2 SV=1 |
| 297 | 262 | Q5RKI0|WDR1_RAT | 90.88 | 10 | 4 | 4 | Y | 66182 |  |
 |
WD repeat-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Wdr1 PE=1 SV=3 |
| 1077 | 4310 | Q9Z2F5|CTBP1_RAT | 90.36 | 12 | 3 | 3 | Y | 46628 |  |
 |
C-terminal-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ctbp1 PE=1 SV=3 |
| 1077 | 25884 | tr|A0A8I5ZSG1|A0A8I5ZSG1_RAT | 90.36 | 14 | 3 | 3 | Y | 40506 | |
|
C-terminal binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ctbp1 PE=1 SV=1 |
| 1077 | 25885 | tr|F7FG31|F7FG31_RAT | 90.36 | 13 | 3 | 3 | Y | 42717 | |
|
C-terminal binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ctbp1 PE=1 SV=2 |
| 1077 | 25886 | tr|A0A0H2UI20|A0A0H2UI20_RAT | 90.36 | 11 | 3 | 3 | Y | 47759 | |
|
C-terminal binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ctbp1 PE=1 SV=2 |
| 230 | 698 | P85834|EFTU_RAT | 90.25 | 19 | 8 | 8 | N | 49522 |  |
 |
Elongation factor Tu, mitochondrial OS=Rattus norvegicus OX=10116 GN=Tufm PE=1 SV=1 |
| 1563 | 3238 | Q5U211|SNX3_RAT | 89.84 | 35 | 3 | 3 | N | 18762 |  |
 |
Sorting nexin-3 OS=Rattus norvegicus OX=10116 GN=Snx3 PE=1 SV=1 |
| 2408 | 6981 | P04646|RL35A_RAT | 89.79 | 21 | 3 | 3 | N | 12554 |  |
 |
Large ribosomal subunit protein eL33 OS=Rattus norvegicus OX=10116 GN=Rpl35a PE=1 SV=1 |
| 2408 | 27066 | tr|D3ZZN4|D3ZZN4_RAT | 89.79 | 21 | 3 | 3 | N | 12623 | |
|
Large ribosomal subunit protein eL33 OS=Rattus norvegicus OX=10116 GN=Rpl35al5 PE=3 SV=1 |
| 2408 | 27067 | tr|A0A8L2QNQ0|A0A8L2QNQ0_RAT | 89.79 | 20 | 3 | 3 | N | 13042 | |
|
Large ribosomal subunit protein eL33 OS=Rattus norvegicus OX=10116 GN=Rpl35al2 PE=3 SV=1 |
| 2408 | 27068 | tr|A0A8I6GLI9|A0A8I6GLI9_RAT | 89.79 | 20 | 3 | 3 | N | 13361 | |
|
Large ribosomal subunit protein eL33 OS=Rattus norvegicus OX=10116 GN=Rpl35a PE=3 SV=1 |
| 2408 | 27072 | tr|A0A8L2QK69|A0A8L2QK69_RAT | 89.79 | 17 | 3 | 3 | N | 15153 | |
|
Large ribosomal subunit protein eL33 OS=Rattus norvegicus OX=10116 GN=Rpl35a PE=3 SV=1 |
| 2408 | 27064 | tr|D4A771|D4A771_RAT | 89.79 | 21 | 3 | 3 | N | 12584 | |
|
Large ribosomal subunit protein eL33 OS=Rattus norvegicus OX=10116 GN=Rpl35al8 PE=3 SV=1 |
| 2408 | 27065 | tr|A0A8I6A5U8|A0A8I6A5U8_RAT | 89.79 | 21 | 3 | 3 | N | 12552 | |
|
Large ribosomal subunit protein eL33 OS=Rattus norvegicus OX=10116 GN=Rpl35al7 PE=3 SV=1 |
| 206 | 23030 | tr|A0A140TAJ3|A0A140TAJ3_RAT | 88.91 | 27 | 11 | 11 | Y | 66617 |  |
 |
Far upstream element binding protein 1 OS=Rattus norvegicus OX=10116 GN=Fubp1 PE=1 SV=2 |
| 206 | 691 | Q32PX7|FUBP1_RAT | 88.91 | 27 | 11 | 11 | Y | 67197 | |
|
Far upstream element-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Fubp1 PE=1 SV=1 |
| 123 | 218 | P28480|TCPA_RAT | 88.44 | 41 | 20 | 20 | Y | 60360 |  |
 |
T-complex protein 1 subunit alpha OS=Rattus norvegicus OX=10116 GN=Tcp1 PE=1 SV=1 |
| 1005 | 24616 | tr|A0A0G2K185|A0A0G2K185_RAT | 87.71 | 8 | 2 | 2 | N | 34087 |  |
 |
Arp2/3 complex 34 kDa subunit OS=Rattus norvegicus OX=10116 GN=Arpc2 PE=1 SV=1 |
| 1005 | 24618 | tr|A0A0H2UHL5|A0A0H2UHL5_RAT | 87.71 | 8 | 2 | 2 | N | 34347 | |
|
Arp2/3 complex 34 kDa subunit OS=Rattus norvegicus OX=10116 GN=Arpc2 PE=3 SV=1 |
| 1005 | 2946 | P85970|ARPC2_RAT | 87.71 | 8 | 2 | 2 | N | 34391 | |
|
Actin-related protein 2/3 complex subunit 2 OS=Rattus norvegicus OX=10116 GN=Arpc2 PE=1 SV=1 |
| 831 | 23708 | tr|A0A8I6A0A3|A0A8I6A0A3_RAT | 87.24 | 12 | 3 | 3 | Y | 53769 |  |
 |
Glutathione reductase OS=Rattus norvegicus OX=10116 GN=Gsr PE=1 SV=1 |
| 1092 | 24849 | tr|Q99MI5|Q99MI5_RAT | 87.09 | 13 | 3 | 3 | Y | 33997 |  |
 |
Spermidine synthase OS=Rattus norvegicus OX=10116 GN=Srm PE=1 SV=1 |
| 1092 | 24854 | tr|M0RCX8|M0RCX8_RAT | 87.09 | 12 | 3 | 3 | Y | 36261 | |
|
Spermidine synthase OS=Rattus norvegicus OX=10116 GN=Srm PE=1 SV=1 |
| 1090 | 24359 | tr|F7EZ84|F7EZ84_RAT | 86.08 | 10 | 2 | 2 | Y | 46609 |  |
 |
Vacuolar protein sorting 4 homolog B OS=Rattus norvegicus OX=10116 GN=Vps4b PE=1 SV=1 |
| 1090 | 24360 | tr|A0A8I6GH80|A0A8I6GH80_RAT | 86.08 | 9 | 2 | 2 | Y | 49451 | |
|
vesicle-fusing ATPase OS=Rattus norvegicus OX=10116 GN=Vps4b PE=1 SV=1 |
| 309 | 3996 | P27881|HXK2_RAT | 84.96 | 8 | 5 | 5 | Y | 102544 |  |
|
Hexokinase-2 OS=Rattus norvegicus OX=10116 GN=Hk2 PE=1 SV=1 |
| 118 | 24623 | tr|A0A8I5ZJ57|A0A8I5ZJ57_RAT | 83.82 | 12 | 8 | 8 | Y | 119866 |  |
 |
FACT complex subunit OS=Rattus norvegicus OX=10116 GN=Supt16h PE=3 SV=1 |
| 1466 | 25443 | tr|A0A0G2JZA2|A0A0G2JZA2_RAT | 83.77 | 17 | 3 | 3 | N | 25812 |  |
 |
GrpE protein homolog OS=Rattus norvegicus OX=10116 GN=Grpel1 PE=1 SV=1 |
| 1466 | 25441 | tr|A0A8I6AMG9|A0A8I6AMG9_RAT | 83.77 | 19 | 3 | 3 | N | 22777 | |
|
GrpE protein homolog OS=Rattus norvegicus OX=10116 GN=Grpel1 PE=1 SV=1 |
| 1466 | 4292 | P97576|GRPE1_RAT | 83.77 | 18 | 3 | 3 | N | 24297 | |
|
GrpE protein homolog 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Grpel1 PE=1 SV=2 |
| 1264 | 3457 | P62959|HINT1_RAT | 82.94 | 21 | 2 | 2 | Y | 13777 |  |
 |
Adenosine 5'-monophosphoramidase HINT1 OS=Rattus norvegicus OX=10116 GN=Hint1 PE=1 SV=5 |
| 1985 | 29081 | tr|D3ZG43|D3ZG43_RAT | 82.92 | 10 | 2 | 2 | N | 30226 |  |
 |
NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ndufs3 PE=3 SV=1 |
| 554 | 25567 | tr|B1WC49|B1WC49_RAT | 82.34 | 18 | 7 | 7 | Y | 56785 |  |
 |
Apoptosis inhibitor 5 OS=Rattus norvegicus OX=10116 GN=Api5 PE=1 SV=1 |
| 1651 | 26686 | tr|A0A8L2QDL7|A0A8L2QDL7_RAT | 82.11 | 2 | 1 | 1 | N | 73706 |  |
 |
Nucleolar and coiled-body phosphoprotein 1 OS=Rattus norvegicus OX=10116 GN=Nolc1 PE=1 SV=1 |
| 132 | 724 | Q99PF5|FUBP2_RAT | 81.76 | 18 | 10 | 10 | Y | 74227 |  |
 |
Far upstream element-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Khsrp PE=1 SV=1 |
| 132 | 23074 | tr|M0R961|M0R961_RAT | 81.76 | 18 | 10 | 10 | Y | 74213 | |
|
KH-type splicing regulatory protein OS=Rattus norvegicus OX=10116 GN=Khsrp PE=1 SV=1 |
| 132 | 23075 | tr|A0A0G2K2B3|A0A0G2K2B3_RAT | 81.76 | 18 | 10 | 10 | Y | 76749 | |
|
KH-type splicing regulatory protein OS=Rattus norvegicus OX=10116 GN=Khsrp PE=1 SV=1 |
| 682 | 1184 | Q4V7C7|ARP3_RAT | 81.05 | 23 | 5 | 5 | Y | 47357 |  |
 |
Actin-related protein 3 OS=Rattus norvegicus OX=10116 GN=Actr3 PE=1 SV=1 |
| 682 | 23408 | tr|A0A0G2K1C0|A0A0G2K1C0_RAT | 81.05 | 23 | 5 | 5 | Y | 47584 | |
|
Actin-related protein 3 OS=Rattus norvegicus OX=10116 GN=Actr3 PE=1 SV=1 |
| 106 | 141 | Q04462|SYVC_RAT | 80.20 | 9 | 7 | 7 | Y | 140368 |  |
 |
Valine--tRNA ligase OS=Rattus norvegicus OX=10116 GN=Vars1 PE=2 SV=2 |
| 1511 | 27331 | tr|D4A1H8|D4A1H8_RAT | 80.19 | 3 | 1 | 1 | N | 55810 |  |
 |
PWP1 homolog, endonuclein OS=Rattus norvegicus OX=10116 GN=Pwp1 PE=1 SV=1 |
| 1118 | 25909 | Q4QQW4|HDAC1_RAT | 79.76 | 12 | 3 | 3 | Y | 55093 |  |
 |
Histone deacetylase 1 OS=Rattus norvegicus OX=10116 GN=Hdac1 PE=1 SV=1 |
| 1118 | 25911 | tr|A0A8I6AG62|A0A8I6AG62_RAT | 79.76 | 12 | 3 | 3 | Y | 55353 | |
|
Histone deacetylase 1 OS=Rattus norvegicus OX=10116 GN=Hdac1 PE=1 SV=1 |
| 30 | 31 | Q9Z1P2|ACTN1_RAT | 79.59 | 2 | 1 | 1 | Y | 102960 |  |
 |
Alpha-actinin-1 OS=Rattus norvegicus OX=10116 GN=Actn1 PE=1 SV=1 |
| 536 | 1546 | Q5XIG8|STRAP_RAT | 79.10 | 33 | 8 | 8 | Y | 38456 |  |
 |
Serine-threonine kinase receptor-associated protein OS=Rattus norvegicus OX=10116 GN=Strap PE=1 SV=1 |
| 536 | 23591 | tr|M0RCV0|M0RCV0_RAT | 79.10 | 33 | 8 | 8 | Y | 37958 | |
|
Serine-threonine kinase receptor-associated protein OS=Rattus norvegicus OX=10116 GN=Strap PE=1 SV=2 |
| 112 | 480 | Q6IMY8|HNRPU_RAT | 78.87 | 1 | 1 | 1 | N | 87733 |  |
 |
Heterogeneous nuclear ribonucleoprotein U OS=Rattus norvegicus OX=10116 GN=Hnrnpu PE=1 SV=1 |
| 112 | 22875 | tr|A0A0G2JZ52|A0A0G2JZ52_RAT | 78.87 | 1 | 1 | 1 | N | 87932 | |
|
Heterogeneous nuclear ribonucleoprotein U OS=Rattus norvegicus OX=10116 GN=Hnrnpu PE=1 SV=1 |
| 54 | 22853 | tr|F1LM33|F1LM33_RAT | 78.71 | 2 | 3 | 3 | N | 157404 |  |
 |
Leucine-rich pentatricopeptide repeat containing OS=Rattus norvegicus OX=10116 GN=Lrpprc PE=1 SV=3 |
| 1363 | 26239 | tr|M0R907|M0R907_RAT | 78.66 | 40 | 3 | 3 | Y | 13916 |  |
 |
Small nuclear ribonucleoprotein Sm D3 OS=Rattus norvegicus OX=10116 GN=Snrpd3 PE=3 SV=1 |
| 1363 | 26240 | tr|A0A8I6AI37|A0A8I6AI37_RAT | 78.66 | 37 | 3 | 3 | Y | 15280 | |
|
Small nuclear ribonucleoprotein Sm D3 OS=Rattus norvegicus OX=10116 GN=Snrpd3 PE=1 SV=1 |
| 1363 | 26238 | tr|A0A8I6AKJ4|A0A8I6AKJ4_RAT | 78.66 | 44 | 3 | 3 | Y | 12822 | |
|
Small nuclear ribonucleoprotein Sm D3 OS=Rattus norvegicus OX=10116 GN=Snrpd3 PE=1 SV=1 |
| 2121 | 42149 | tr|A0A8I6GLY3|A0A8I6GLY3_RAT | 78.19 | 3 | 1 | 1 | N | 50830 |  |
 |
Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit OS=Rattus norvegicus OX=10116 GN=Ppp2r5e PE=1 SV=1 |
| 2121 | 42148 | tr|D3ZHI9|D3ZHI9_RAT | 78.19 | 3 | 1 | 1 | N | 50347 | |
|
Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit OS=Rattus norvegicus OX=10116 GN=Ppp2r5e PE=1 SV=1 |
| 2121 | 42150 | tr|A0A0G2JTA1|A0A0G2JTA1_RAT | 78.19 | 3 | 1 | 1 | N | 53971 | |
|
Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit OS=Rattus norvegicus OX=10116 GN=Ppp2r5e PE=1 SV=2 |
| 2121 | 42151 | tr|A0A8I5ZMG6|A0A8I5ZMG6_RAT | 78.19 | 3 | 1 | 1 | N | 54714 | |
|
Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit OS=Rattus norvegicus OX=10116 GN=Ppp2r5e PE=1 SV=1 |
| 1545 | 4517 | P32089|TXTP_RAT | 78.17 | 4 | 1 | 1 | N | 33835 |  |
 |
Tricarboxylate transport protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Slc25a1 PE=1 SV=1 |
| 1545 | 25477 | tr|A0A8I6AEC6|A0A8I6AEC6_RAT | 78.17 | 4 | 1 | 1 | N | 32446 | |
|
Citrate transport protein OS=Rattus norvegicus OX=10116 GN=Slc25a1 PE=1 SV=1 |
| 1679 | 25973 | tr|Q9ET50|Q9ET50_RAT | 78.17 | 5 | 2 | 2 | N | 54802 |  |
 |
Staufen double-stranded RNA binding protein 1 OS=Rattus norvegicus OX=10116 GN=Stau1 PE=1 SV=1 |
| 731 | 24361 | tr|A0A8L2Q0U6|A0A8L2Q0U6_RAT | 77.82 | 6 | 1 | 1 | Y | 37924 |  |
 |
Pyrroline-5-carboxylate reductase OS=Rattus norvegicus OX=10116 GN=Pycr2 PE=1 SV=1 |
| 695 | 30726 | Q9WTT7|5MP1_RAT | 77.65 | 5 | 1 | 1 | N | 48049 |  |
 |
eIF5-mimic protein 1 OS=Rattus norvegicus OX=10116 GN=Bzw2 PE=1 SV=1 |
| 695 | 81250 | tr|A0A8I5ZSL9|A0A8I5ZSL9_RAT | 77.65 | 4 | 1 | 1 | N | 49127 | |
|
eIF5-mimic protein 1 OS=Rattus norvegicus OX=10116 GN=Bzw2 PE=1 SV=1 |
| 207 | 23082 | tr|D4A133|D4A133_RAT | 77.49 | 19 | 8 | 8 | Y | 71401 |  |
 |
H(+)-transporting two-sector ATPase OS=Rattus norvegicus OX=10116 GN=Atp6v1a PE=1 SV=2 |
| 466 | 24754 | tr|G3V8Y5|G3V8Y5_RAT | 77.21 | 9 | 6 | 6 | N | 133896 |  |
 |
DNA-directed RNA polymerase subunit beta OS=Rattus norvegicus OX=10116 GN=Polr2b PE=3 SV=1 |
| 53 | 125 | P06685|AT1A1_RAT | 76.86 | 10 | 8 | 8 | Y | 113054 |  |
 |
Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Atp1a1 PE=1 SV=1 |
| 2682 | 42941 | tr|G3V9M8|G3V9M8_RAT | 76.66 | 5 | 1 | 1 | N | 40210 |  |
 |
Family with sequence similarity 50, member A OS=Rattus norvegicus OX=10116 GN=Fam50a PE=4 SV=1 |
| 1166 | 26739 | tr|D4ACW1|D4ACW1_RAT | 76.36 | 4 | 2 | 2 | Y | 85385 |  |
 |
NOP2 nucleolar protein OS=Rattus norvegicus OX=10116 GN=Nop2 PE=1 SV=3 |
| 1461 | 3661 | Q9Z118|PTBP3_RAT | 76.24 | 3 | 1 | 1 | Y | 56716 |  |
 |
Polypyrimidine tract-binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ptbp3 PE=2 SV=1 |
| 1461 | 25032 | tr|A0A8L2UJS5|A0A8L2UJS5_RAT | 76.24 | 3 | 1 | 1 | Y | 56397 | |
|
Polypyrimidine tract binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ptbp3 PE=1 SV=1 |
| 1461 | 25033 | tr|A0A0G2JV54|A0A0G2JV54_RAT | 76.24 | 3 | 1 | 1 | Y | 58525 | |
|
Polypyrimidine tract binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ptbp3 PE=1 SV=2 |
| 1516 | 3604 | Q5U2U2|CRKL_RAT | 76.22 | 18 | 4 | 4 | Y | 33865 |  |
 |
Crk-like protein OS=Rattus norvegicus OX=10116 GN=Crkl PE=1 SV=1 |
| 173 | 22891 | tr|F1M9V7|F1M9V7_RAT | 76.18 | 24 | 16 | 16 | N | 103344 |  |
 |
Aminopeptidase OS=Rattus norvegicus OX=10116 GN=Npepps PE=1 SV=1 |
| 121 | 442 | Q9JLA3|UGGG1_RAT | 76.11 | 2 | 2 | 2 | N | 176430 |  |
 |
UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2 |
| 121 | 22863 | tr|A0A8I5ZR75|A0A8I5ZR75_RAT | 76.11 | 2 | 2 | 2 | N | 175534 | |
|
UDP-glucose glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=1 |
| 1094 | 26741 | tr|Q5RJK5|Q5RJK5_RAT | 74.70 | 21 | 4 | 4 | Y | 20811 |  |
 |
Chromobox 3 OS=Rattus norvegicus OX=10116 GN=Cbx3 PE=1 SV=1 |
| 495 | 23859 | tr|F1LQJ7|F1LQJ7_RAT | 74.53 | 2 | 1 | 1 | N | 73697 |  |
 |
phosphoenolpyruvate carboxykinase (GTP) OS=Rattus norvegicus OX=10116 GN=Pck2 PE=1 SV=3 |
| 495 | 23905 | tr|A0A8I6AH39|A0A8I6AH39_RAT | 74.53 | 2 | 1 | 1 | N | 71437 | |
|
phosphoenolpyruvate carboxykinase (GTP) OS=Rattus norvegicus OX=10116 GN=Pck2 PE=1 SV=1 |
| 329 | 23254 | tr|D3ZUY8|D3ZUY8_RAT | 74.48 | 7 | 5 | 5 | Y | 105589 |  |
 |
AP-2 complex subunit alpha OS=Rattus norvegicus OX=10116 GN=Ap2a1 PE=1 SV=2 |
| 329 | 23257 | tr|A0A8I6A4J2|A0A8I6A4J2_RAT | 74.48 | 7 | 5 | 5 | Y | 111828 | |
|
AP-2 complex subunit alpha OS=Rattus norvegicus OX=10116 GN=Ap2a1 PE=1 SV=1 |
| 701 | 23980 | Q5M7V8|TR150_RAT | 74.28 | 4 | 3 | 3 | N | 108252 |  |
 |
Thyroid hormone receptor-associated protein 3 OS=Rattus norvegicus OX=10116 GN=Thrap3 PE=1 SV=1 |
| 1486 | 25085 | tr|A0A0G2K977|A0A0G2K977_RAT | 73.94 | 2 | 1 | 1 | N | 115930 |  |
 |
Golgin A2 OS=Rattus norvegicus OX=10116 GN=Golga2 PE=1 SV=1 |
| 1486 | 25081 | tr|A0A8I5ZMK4|A0A8I5ZMK4_RAT | 73.94 | 2 | 1 | 1 | N | 111081 | |
|
Golgin A2 OS=Rattus norvegicus OX=10116 GN=Golga2 PE=1 SV=1 |
| 751 | 2503 | Q02874|H2AY_RAT | 73.20 | 5 | 2 | 2 | N | 39040 |  |
 |
Core histone macro-H2A.1 OS=Rattus norvegicus OX=10116 GN=Macroh2a1 PE=1 SV=5 |
| 751 | 24319 | tr|A0A140TAB4|A0A140TAB4_RAT | 73.20 | 5 | 2 | 2 | N | 39199 | |
|
Core histone macro-H2A OS=Rattus norvegicus OX=10116 GN=Macroh2a1 PE=1 SV=2 |
| 184 | 23145 | tr|D3ZPR0|D3ZPR0_RAT | 72.59 | 12 | 10 | 10 | Y | 110214 |  |
 |
Exportin-2 OS=Rattus norvegicus OX=10116 GN=Cse1l PE=3 SV=1 |
| 370 | 23696 | tr|D3ZYS7|D3ZYS7_RAT | 72.21 | 22 | 6 | 6 | N | 51787 |  |
 |
G3BP stress granule assembly factor 1 OS=Rattus norvegicus OX=10116 GN=G3bp1 PE=1 SV=1 |
| 826 | 3918 | Q4KLL0|TCEA1_RAT | 72.03 | 18 | 4 | 4 | Y | 33894 |  |
 |
Transcription elongation factor A protein 1 OS=Rattus norvegicus OX=10116 GN=Tcea1 PE=1 SV=1 |
| 826 | 25240 | tr|A0A8L2Q4Y0|A0A8L2Q4Y0_RAT | 72.03 | 18 | 4 | 4 | Y | 34019 | |
|
Transcription elongation factor OS=Rattus norvegicus OX=10116 GN=Tcea1 PE=3 SV=1 |
| 3250 | 9876 | Q9WVA1|TIM8A_RAT | 71.78 | 11 | 1 | 1 | Y | 11042 |  |
 |
Mitochondrial import inner membrane translocase subunit Tim8 A OS=Rattus norvegicus OX=10116 GN=Timm8a PE=1 SV=1 |
| 1235 | 24752 | tr|A0A8I5ZUH2|A0A8I5ZUH2_RAT | 71.54 | 5 | 2 | 2 | N | 81920 |  |
 |
Striatin 3 OS=Rattus norvegicus OX=10116 GN=Strn3 PE=1 SV=1 |
| 1235 | 24794 | tr|E9PT82|E9PT82_RAT | 71.54 | 5 | 2 | 2 | N | 77629 | |
|
Striatin 3 OS=Rattus norvegicus OX=10116 GN=Strn3 PE=1 SV=1 |
| 1235 | 3267 | P58405|STRN3_RAT | 71.54 | 5 | 2 | 2 | N | 87111 | |
|
Striatin-3 OS=Rattus norvegicus OX=10116 GN=Strn3 PE=1 SV=2 |
| 1235 | 24797 | tr|A0A8I6AGH7|A0A8I6AGH7_RAT | 71.54 | 5 | 2 | 2 | N | 82751 | |
|
Striatin 3 OS=Rattus norvegicus OX=10116 GN=Strn3 PE=1 SV=1 |
| 635 | 4899 | Q5XIH7|PHB2_RAT | 71.21 | 31 | 8 | 8 | N | 33312 |  |
 |
Prohibitin-2 OS=Rattus norvegicus OX=10116 GN=Phb2 PE=1 SV=1 |
| 635 | 25769 | tr|A0A8L2Q8H9|A0A8L2Q8H9_RAT | 71.21 | 32 | 8 | 8 | N | 32511 | |
|
Prohibitin OS=Rattus norvegicus OX=10116 GN=Phb2 PE=1 SV=1 |
| 635 | 25770 | tr|A0A0G2KB63|A0A0G2KB63_RAT | 71.21 | 32 | 8 | 8 | N | 33168 | |
|
Prohibitin OS=Rattus norvegicus OX=10116 GN=Phb2 PE=1 SV=1 |
| 2558 | 27180 | Q71TY3|RS27_RAT | 70.77 | 14 | 2 | 2 | N | 9461 |  |
 |
Small ribosomal subunit protein eS27 OS=Rattus norvegicus OX=10116 GN=Rps27 PE=1 SV=3 |
| 704 | 24787 | tr|D4A9L2|D4A9L2_RAT | 70.49 | 33 | 7 | 7 | Y | 27745 |  |
 |
Serine/arginine-rich splicing factor 1 OS=Rattus norvegicus OX=10116 GN=Srsf1 PE=1 SV=1 |
| 704 | 24788 | tr|A0A8I6GMR8|A0A8I6GMR8_RAT | 70.49 | 32 | 7 | 7 | Y | 28329 | |
|
Serine/arginine-rich splicing factor 1 OS=Rattus norvegicus OX=10116 GN=Srsf1 PE=1 SV=1 |
| 2648 | 43578 | Q5BJQ6|CSTF1_RAT | 70.25 | 4 | 1 | 1 | N | 48382 |  |
 |
Cleavage stimulation factor subunit 1 OS=Rattus norvegicus OX=10116 GN=Cstf1 PE=2 SV=1 |
| 967 | 24407 | tr|D4A857|D4A857_RAT | 69.12 | 6 | 4 | 4 | Y | 116650 |  |
 |
Importin 9 OS=Rattus norvegicus OX=10116 GN=Ipo9 PE=4 SV=3 |
| 285 | 23629 | tr|A0A8I5ZME8|A0A8I5ZME8_RAT | 68.98 | 19 | 8 | 8 | N | 63726 |  |
 |
Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus OX=10116 GN=Puf60 PE=1 SV=1 |
| 1019 | 2225 | O35509|RB11B_RAT | 68.75 | 9 | 2 | 2 | N | 24488 |  |
 |
Ras-related protein Rab-11B OS=Rattus norvegicus OX=10116 GN=Rab11b PE=1 SV=4 |
| 2509 | 26893 | tr|B2RYQ5|B2RYQ5_RAT | 68.62 | 38 | 3 | 3 | Y | 12259 |  |
 |
Enhancer of rudimentary homolog OS=Rattus norvegicus OX=10116 GN=Erh PE=3 SV=1 |
| 134 | 311 | Q4FZT9|PSMD2_RAT | 68.39 | 23 | 15 | 15 | Y | 100188 |  |
 |
26S proteasome non-ATPase regulatory subunit 2 OS=Rattus norvegicus OX=10116 GN=Psmd2 PE=1 SV=1 |
| 2694 | 6641 | P62859|RS28_RAT | 68.37 | 46 | 3 | 3 | Y | 7841 |  |
 |
Small ribosomal subunit protein eS28 OS=Rattus norvegicus OX=10116 GN=Rps28 PE=1 SV=1 |
| 1986 | 31107 | tr|D4A3I4|D4A3I4_RAT | 68.03 | 19 | 2 | 2 | N | 17271 |  |
 |
Transcription factor BTF3 OS=Rattus norvegicus OX=10116 GN=Btf3l4 PE=3 SV=1 |
| 1464 | 24422 | tr|Q5BJT9|Q5BJT9_RAT | 67.85 | 19 | 4 | 4 | Y | 46962 |  |
 |
Creatine kinase U-type, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ckmt1 PE=1 SV=1 |
| 2432 | 28881 | tr|D3ZDU5|D3ZDU5_RAT | 67.78 | 9 | 1 | 1 | N | 16027 |  |
 |
Profilin OS=Rattus norvegicus OX=10116 GN=Pfn2 PE=3 SV=1 |
| 2432 | 9077 | Q9EPC6|PROF2_RAT | 67.78 | 10 | 1 | 1 | N | 15002 | |
|
Profilin-2 OS=Rattus norvegicus OX=10116 GN=Pfn2 PE=1 SV=3 |
| 98 | 447 | Q68FQ0|TCPE_RAT | 67.72 | 29 | 16 | 16 | Y | 59537 |  |
 |
T-complex protein 1 subunit epsilon OS=Rattus norvegicus OX=10116 GN=Cct5 PE=1 SV=1 |
| 32 | 21 | P82995|HS90A_RAT | 67.63 | 26 | 19 | 19 | Y | 84815 |  |
 |
Heat shock protein HSP 90-alpha OS=Rattus norvegicus OX=10116 GN=Hsp90aa1 PE=1 SV=3 |
| 1102 | 3097 | Q5HZV9|PP1R7_RAT | 66.92 | 7 | 2 | 2 | N | 41297 |  |
 |
Protein phosphatase 1 regulatory subunit 7 OS=Rattus norvegicus OX=10116 GN=Ppp1r7 PE=1 SV=1 |
| 1102 | 24828 | tr|A0A8I6AM99|A0A8I6AM99_RAT | 66.92 | 7 | 2 | 2 | N | 41963 | |
|
Protein phosphatase 1, regulatory subunit 7 OS=Rattus norvegicus OX=10116 GN=Ppp1r7 PE=1 SV=1 |
| 1768 | 5689 | Q75Q41|TOM22_RAT | 66.82 | 27 | 3 | 3 | N | 15491 |  |
 |
Mitochondrial import receptor subunit TOM22 homolog OS=Rattus norvegicus OX=10116 GN=Tomm22 PE=1 SV=1 |
| 318 | 875 | Q09073|ADT2_RAT | 66.60 | 8 | 3 | 3 | Y | 32901 |  |
 |
ADP/ATP translocase 2 OS=Rattus norvegicus OX=10116 GN=Slc25a5 PE=1 SV=3 |
| 41 | 22677 | tr|A6JR01|A6JR01_RAT | 66.28 | 19 | 15 | 15 | Y | 141695 |  |
 |
High density lipoprotein binding protein OS=Rattus norvegicus OX=10116 GN=Hdlbp PE=1 SV=1 |
| 1514 | 3360 | Q62847|ADDG_RAT | 66.05 | 4 | 2 | 2 | N | 78818 |  |
 |
Gamma-adducin OS=Rattus norvegicus OX=10116 GN=Add3 PE=1 SV=3 |
| 1467 | 25635 | tr|A0A8I6GEL5|A0A8I6GEL5_RAT | 66.00 | 32 | 5 | 5 | N | 23954 |  |
 |
40S ribosomal protein S7 OS=Rattus norvegicus OX=10116 GN=Rps7 PE=1 SV=1 |
| 1467 | 4500 | P62083|RS7_RAT | 66.00 | 35 | 5 | 5 | N | 22127 | |
|
Small ribosomal subunit protein eS7 OS=Rattus norvegicus OX=10116 GN=Rps7 PE=1 SV=1 |
| 1467 | 25634 | tr|A0A8L2RB77|A0A8L2RB77_RAT | 66.00 | 34 | 5 | 5 | N | 22276 | |
|
40S ribosomal protein S7 OS=Rattus norvegicus OX=10116 GN=Rps7 PE=1 SV=1 |
| 1559 | 61034 | Q27W01|RBM8A_RAT | 65.65 | 32 | 4 | 4 | Y | 19889 |  |
 |
RNA-binding protein 8A OS=Rattus norvegicus OX=10116 GN=Rbm8a PE=1 SV=1 |
| 824 | 3737 | P62804|H4_RAT | 65.41 | 53 | 9 | 9 | Y | 11367 |  |
 |
Histone H4 OS=Rattus norvegicus OX=10116 GN=H4c2 PE=1 SV=2 |
| 165 | 22854 | tr|Q6P3V8|Q6P3V8_RAT | 65.37 | 30 | 12 | 12 | Y | 46154 |  |
 |
Eukaryotic initiation factor 4A-I OS=Rattus norvegicus OX=10116 GN=Eif4a1 PE=3 SV=1 |
| 165 | 22855 | tr|F7F7A6|F7F7A6_RAT | 65.37 | 30 | 12 | 12 | Y | 46853 | |
|
Eukaryotic initiation factor 4A-I OS=Rattus norvegicus OX=10116 GN=Eif4a1 PE=1 SV=1 |
| 2441 | 5190 | P60905|DNJC5_RAT | 65.01 | 28 | 3 | 3 | N | 22101 |  |
 |
DnaJ homolog subfamily C member 5 OS=Rattus norvegicus OX=10116 GN=Dnajc5 PE=1 SV=1 |
| 2441 | 26178 | tr|A0A0G2JX56|A0A0G2JX56_RAT | 65.01 | 34 | 3 | 3 | N | 18753 | |
|
DnaJ homolog subfamily C member 5 OS=Rattus norvegicus OX=10116 GN=Dnajc5 PE=4 SV=1 |
| 2441 | 26179 | tr|A0A8I6A9F3|A0A8I6A9F3_RAT | 65.01 | 29 | 3 | 3 | N | 21529 | |
|
DnaJ homolog subfamily C member 5 OS=Rattus norvegicus OX=10116 GN=Dnajc5 PE=1 SV=1 |
| 445 | 24063 | tr|A0A8I6G2B2|A0A8I6G2B2_RAT | 64.67 | 13 | 5 | 5 | Y | 68895 |  |
 |
Signal recognition particle subunit SRP68 OS=Rattus norvegicus OX=10116 GN=Srp68 PE=1 SV=1 |
| 445 | 24064 | tr|B2RYI2|B2RYI2_RAT | 64.67 | 12 | 5 | 5 | Y | 70492 | |
|
Signal recognition particle subunit SRP68 OS=Rattus norvegicus OX=10116 GN=Srp68 PE=3 SV=1 |
| 1570 | 26041 | tr|A0A8I5YBE8|A0A8I5YBE8_RAT | 64.62 | 18 | 4 | 4 | N | 34884 |  |
 |
Purine rich element binding protein A OS=Rattus norvegicus OX=10116 GN=Pura PE=1 SV=1 |
| 1076 | 2986 | P84083|ARF5_RAT | 64.10 | 14 | 2 | 2 | N | 20530 |  |
 |
ADP-ribosylation factor 5 OS=Rattus norvegicus OX=10116 GN=Arf5 PE=1 SV=2 |
| 1076 | 24651 | tr|A0A8L2Q5I9|A0A8L2Q5I9_RAT | 64.10 | 9 | 2 | 2 | N | 32311 | |
|
ADP-ribosylation factor 5 OS=Rattus norvegicus OX=10116 GN=Arf5 PE=1 SV=1 |
| 2460 | 30031 | tr|A0A8I6A7S3|A0A8I6A7S3_RAT | 64.00 | 4 | 1 | 1 | N | 33852 |  |
 |
ATP synthase mitochondrial F1 complex assembly factor 2 OS=Rattus norvegicus OX=10116 GN=Atpaf2 PE=1 SV=1 |
| 2460 | 30032 | tr|D3ZTW7|D3ZTW7_RAT | 64.00 | 4 | 1 | 1 | N | 34192 | |
|
ATP synthase mitochondrial F1 complex assembly factor 2 OS=Rattus norvegicus OX=10116 GN=Atpaf2 PE=3 SV=1 |
| 169 | 22721 | tr|A6IXU7|A6IXU7_RAT | 63.92 | 3 | 1 | 1 | N | 50059 |  |
 |
Tubulin beta chain OS=Rattus norvegicus OX=10116 GN=Tubb6 PE=1 SV=1 |
| 2138 | 26981 | tr|D3ZYH3|D3ZYH3_RAT | 63.66 | 18 | 2 | 2 | Y | 18593 |  |
 |
diphosphoinositol-polyphosphate diphosphatase OS=Rattus norvegicus OX=10116 GN=Nudt11 PE=3 SV=1 |
| 201 | 382 | O08629|TIF1B_RAT | 63.65 | 17 | 10 | 10 | Y | 88956 |  |
 |
Transcription intermediary factor 1-beta OS=Rattus norvegicus OX=10116 GN=Trim28 PE=1 SV=2 |
| 1648 | 26063 | tr|A0A8I5ZRF0|A0A8I5ZRF0_RAT | 62.89 | 15 | 2 | 2 | N | 21511 |  |
 |
Tumor protein D52 OS=Rattus norvegicus OX=10116 GN=Tpd52 PE=1 SV=1 |
| 1648 | 26150 | tr|A0A0G2K865|A0A0G2K865_RAT | 62.89 | 12 | 2 | 2 | N | 26786 | |
|
Tumor protein D52 OS=Rattus norvegicus OX=10116 GN=Tpd52 PE=1 SV=2 |
| 1822 | 26882 | tr|M0RBB1|M0RBB1_RAT | 62.66 | 23 | 4 | 4 | N | 27027 |  |
 |
Aly/REF export factor OS=Rattus norvegicus OX=10116 GN=Alyref PE=4 SV=3 |
| 1688 | 2806 | Q63468|KPRA_RAT | 62.62 | 8 | 2 | 2 | Y | 39436 |  |
 |
Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Prpsap1 PE=1 SV=1 |
| 1688 | 24331 | tr|G3V7B5|G3V7B5_RAT | 62.62 | 7 | 2 | 2 | Y | 42503 | |
|
Phosphoribosyl pyrophosphate synthetase-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Prpsap1 PE=3 SV=1 |
| 1361 | 25684 | tr|A0A8I5ZQ10|A0A8I5ZQ10_RAT | 62.44 | 43 | 7 | 7 | Y | 21671 |  |
 |
N-alpha-acetyltransferase 50 OS=Rattus norvegicus OX=10116 GN=Naa50 PE=1 SV=1 |
| 1361 | 25681 | tr|A0A8I6G5M7|A0A8I6G5M7_RAT | 62.44 | 49 | 7 | 7 | Y | 19159 | |
|
N-alpha-acetyltransferase 50 OS=Rattus norvegicus OX=10116 GN=Naa50 PE=1 SV=1 |
| 1361 | 25682 | tr|D4A5Y6|D4A5Y6_RAT | 62.44 | 49 | 7 | 7 | Y | 19301 | |
|
N-alpha-acetyltransferase 50 OS=Rattus norvegicus OX=10116 GN=Naa50 PE=3 SV=1 |
| 1361 | 25683 | tr|A0A8I6A8V0|A0A8I6A8V0_RAT | 62.44 | 47 | 7 | 7 | Y | 19828 | |
|
N-alpha-acetyltransferase 50 OS=Rattus norvegicus OX=10116 GN=Naa50 PE=1 SV=1 |
| 1862 | 27344 | tr|D3ZZ95|D3ZZ95_RAT | 62.24 | 30 | 3 | 3 | Y | 12410 |  |
 |
60S ribosomal protein L36 OS=Rattus norvegicus OX=10116 GN=Rpl36l3 PE=1 SV=1 |
| 557 | 24150 | tr|A0A8J8YFS5|A0A8J8YFS5_RAT | 62.08 | 12 | 4 | 4 | N | 56502 |  |
 |
Histidine--tRNA ligase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Hars1 PE=1 SV=1 |
| 506 | 1749 | Q63525|NUDC_RAT | 61.76 | 13 | 4 | 4 | N | 38412 |  |
 |
Nuclear migration protein nudC OS=Rattus norvegicus OX=10116 GN=Nudc PE=1 SV=1 |
| 506 | 23712 | tr|A0A0G2K0V8|A0A0G2K0V8_RAT | 61.76 | 14 | 4 | 4 | N | 36808 | |
|
Nuclear distribution C, dynein complex regulator OS=Rattus norvegicus OX=10116 GN=Nudc PE=1 SV=2 |
| 63 | 104 | Q66X93|SND1_RAT | 61.67 | 12 | 9 | 9 | Y | 101952 |  |
 |
Staphylococcal nuclease domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Snd1 PE=1 SV=1 |
| 2543 | 4668 | A2RUW1|TOLIP_RAT | 61.37 | 5 | 1 | 1 | N | 30315 |  |
 |
Toll-interacting protein OS=Rattus norvegicus OX=10116 GN=Tollip PE=1 SV=1 |
| 2543 | 25694 | tr|A0A8I6ACI3|A0A8I6ACI3_RAT | 61.37 | 6 | 1 | 1 | N | 24570 | |
|
Toll interacting protein OS=Rattus norvegicus OX=10116 GN=Tollip PE=1 SV=1 |
| 308 | 1089 | P30349|LKHA4_RAT | 60.50 | 14 | 6 | 6 | Y | 69089 |  |
 |
Leukotriene A-4 hydrolase OS=Rattus norvegicus OX=10116 GN=Lta4h PE=1 SV=3 |
| 644 | 27030 | P55266|DSRAD_RAT | 60.41 | 2 | 1 | 1 | Y | 129911 |  |
 |
Double-stranded RNA-specific adenosine deaminase OS=Rattus norvegicus OX=10116 GN=Adar PE=1 SV=1 |
| 422 | 24020 | tr|M0RBF0|M0RBF0_RAT | 60.11 | 3 | 1 | 1 | Y | 104294 |  |
 |
Scaffold attachment factor B OS=Rattus norvegicus OX=10116 GN=Safb PE=1 SV=2 |
| 401 | 22980 | tr|D3ZAN3|D3ZAN3_RAT | 59.98 | 9 | 6 | 6 | N | 90573 |  |
 |
Glucosidase II alpha subunit OS=Rattus norvegicus OX=10116 GN=Ganab PE=1 SV=1 |
| 401 | 22979 | tr|A0A8I6GFL3|A0A8I6GFL3_RAT | 59.98 | 9 | 6 | 6 | N | 87755 | |
|
Glucosidase II alpha subunit OS=Rattus norvegicus OX=10116 GN=Ganab PE=1 SV=1 |
| 128 | 22958 | tr|A0A8I6AUZ1|A0A8I6AUZ1_RAT | 59.73 | 2 | 2 | 2 | N | 108283 |  |
 |
Hexokinase-1 OS=Rattus norvegicus OX=10116 GN=Hk1 PE=1 SV=1 |
| 2502 | 26054 | tr|A0A8I6AFT8|A0A8I6AFT8_RAT | 59.68 | 32 | 3 | 3 | Y | 14585 |  |
 |
Splicing factor 3B, subunit 6 OS=Rattus norvegicus OX=10116 GN=Sf3b6 PE=4 SV=1 |
| 2502 | 26055 | tr|M0R835|M0R835_RAT | 59.68 | 32 | 3 | 3 | Y | 14794 | |
|
Splicing factor 3B, subunit 6 OS=Rattus norvegicus OX=10116 GN=Sf3b6 PE=1 SV=3 |
| 306 | 22935 | tr|G3V8A5|G3V8A5_RAT | 59.60 | 13 | 8 | 8 | N | 91727 |  |
 |
Vacuolar protein sorting-associated protein 35 OS=Rattus norvegicus OX=10116 GN=Vps35 PE=1 SV=1 |
| 2078 | 7278 | P63029|TCTP_RAT | 59.08 | 8 | 1 | 1 | Y | 19462 |  |
 |
Translationally-controlled tumor protein OS=Rattus norvegicus OX=10116 GN=Tpt1 PE=1 SV=1 |
| 2078 | 27105 | tr|A0A8I5ZVT0|A0A8I5ZVT0_RAT | 59.08 | 7 | 1 | 1 | Y | 19865 | |
|
Translationally-controlled tumor protein OS=Rattus norvegicus OX=10116 GN=Tpt1 PE=1 SV=1 |
| 1039 | 25564 | tr|A0A8I6AAH5|A0A8I6AAH5_RAT | 58.24 | 2 | 1 | 1 | N | 106176 |  |
 |
O-GlcNAcase OS=Rattus norvegicus OX=10116 GN=Oga PE=1 SV=1 |
| 1769 | 24670 | tr|F2Z3T7|F2Z3T7_RAT | 58.15 | 20 | 4 | 4 | N | 32033 |  |
 |
Isochorismatase domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Isoc1 PE=1 SV=1 |
| 980 | 1955 | Q6AYK6|CYBP_RAT | 57.97 | 16 | 4 | 4 | Y | 26541 |  |
 |
Calcyclin-binding protein OS=Rattus norvegicus OX=10116 GN=Cacybp PE=1 SV=1 |
| 43 | 22825 | tr|E9PT66|E9PT66_RAT | 57.82 | 18 | 15 | 15 | Y | 135550 |  |
 |
Splicing factor 3B subunit 3 OS=Rattus norvegicus OX=10116 GN=Sf3b3 PE=1 SV=2 |
| 1178 | 2548 | P62718|RL18A_RAT | 57.70 | 12 | 2 | 2 | Y | 20732 |  |
 |
Large ribosomal subunit protein eL20 OS=Rattus norvegicus OX=10116 GN=Rpl18a PE=1 SV=1 |
| 541 | 25467 | tr|D3ZDD7|D3ZDD7_RAT | 57.67 | 2 | 1 | 1 | N | 73725 |  |
 |
Spermatid perinuclear RNA-binding protein OS=Rattus norvegicus OX=10116 GN=Strbp PE=4 SV=1 |
| 921 | 41834 | tr|D3ZWA8|D3ZWA8_RAT | 57.15 | 3 | 1 | 1 | Y | 79364 |  |
 |
Adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 1 OS=Rattus norvegicus OX=10116 GN=Appl1 PE=1 SV=4 |
| 1632 | 25043 | tr|A0A0G2K850|A0A0G2K850_RAT | 56.55 | 15 | 6 | 6 | Y | 64839 |  |
 |
EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=1 SV=2 |
| 1632 | 25045 | tr|A0A8J8Y9N6|A0A8J8Y9N6_RAT | 56.55 | 14 | 6 | 6 | Y | 68241 | |
|
EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=1 SV=1 |
| 1632 | 25046 | tr|B1WC50|B1WC50_RAT | 56.55 | 14 | 6 | 6 | Y | 68331 | |
|
EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=3 SV=1 |
| 1632 | 25047 | tr|A0A140UHY3|A0A140UHY3_RAT | 56.55 | 14 | 6 | 6 | Y | 68906 | |
|
EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=3 SV=1 |
| 1920 | 42794 | Q6AY65|ARFP2_RAT | 55.75 | 5 | 1 | 1 | N | 37773 |  |
 |
Arfaptin-2 OS=Rattus norvegicus OX=10116 GN=Arfip2 PE=2 SV=1 |
| 829 | 3944 | Q80Z29|NAMPT_RAT | 55.36 | 14 | 4 | 4 | N | 55438 |  |
 |
Nicotinamide phosphoribosyltransferase OS=Rattus norvegicus OX=10116 GN=Nampt PE=1 SV=1 |
| 413 | 22970 | tr|D3ZVQ0|D3ZVQ0_RAT | 55.27 | 7 | 3 | 3 | N | 95779 |  |
 |
Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp5 PE=1 SV=1 |
| 413 | 22969 | tr|A0A8I5ZLA4|A0A8I5ZLA4_RAT | 55.27 | 8 | 3 | 3 | N | 87326 | |
|
Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp5 PE=1 SV=1 |
| 1771 | 25825 | tr|G3V8F5|G3V8F5_RAT | 55.15 | 11 | 3 | 3 | N | 37920 |  |
 |
Mitochondrial import receptor subunit TOM40 homolog OS=Rattus norvegicus OX=10116 GN=Tomm40 PE=3 SV=1 |
| 1738 | 27475 | tr|A0A096MJB3|A0A096MJB3_RAT | 55.05 | 9 | 2 | 2 | N | 35079 |  |
 |
WD repeat domain 82 OS=Rattus norvegicus OX=10116 GN=Wdr82 PE=3 SV=2 |
| 1738 | 27476 | tr|M0R565|M0R565_RAT | 55.05 | 9 | 2 | 2 | N | 35280 | |
|
WD repeat domain 82 OS=Rattus norvegicus OX=10116 GN=Wdr82 PE=1 SV=3 |
| 2661 | 26901 | tr|A0A8I5ZNR5|A0A8I5ZNR5_RAT | 54.36 | 5 | 1 | 1 | N | 51394 |  |
 |
UBX domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Ubxn4 PE=1 SV=1 |
| 2661 | 26902 | tr|A0A8L2Q1Y1|A0A8L2Q1Y1_RAT | 54.36 | 4 | 1 | 1 | N | 51422 | |
|
UBX domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Ubxn4 PE=1 SV=1 |
| 2661 | 26903 | tr|A0A8I5ZL25|A0A8I5ZL25_RAT | 54.36 | 4 | 1 | 1 | N | 56481 | |
|
UBX domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Ubxn4 PE=1 SV=1 |
| 2661 | 42222 | Q5HZY0|UBXN4_RAT | 54.36 | 4 | 1 | 1 | N | 56394 | |
|
UBX domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Ubxn4 PE=1 SV=1 |
| 863 | 42254 | tr|Q3B7U1|Q3B7U1_RAT | 54.30 | 2 | 1 | 1 | N | 65754 |  |
 |
MAGE family member D2 OS=Rattus norvegicus OX=10116 GN=Maged2 PE=1 SV=1 |
| 491 | 23154 | tr|A0A8I5ZTF9|A0A8I5ZTF9_RAT | 54.30 | 10 | 2 | 2 | Y | 32988 |  |
 |
Aldo-keto reductase family 1 member B1 OS=Rattus norvegicus OX=10116 GN=Akr1b1 PE=1 SV=1 |
| 491 | 952 | P07943|ALDR_RAT | 54.30 | 9 | 2 | 2 | Y | 35797 | |
|
Aldo-keto reductase family 1 member B1 OS=Rattus norvegicus OX=10116 GN=Akr1b1 PE=1 SV=3 |
| 482 | 25440 | tr|D4A0E8|D4A0E8_RAT | 54.26 | 9 | 6 | 6 | Y | 72695 |  |
 |
Protein arginine N-methyltransferase 5 OS=Rattus norvegicus OX=10116 GN=Prmt5 PE=3 SV=1 |
| 584 | 26501 | tr|A0A0H2UHZ4|A0A0H2UHZ4_RAT | 54.01 | 18 | 4 | 4 | N | 36281 |  |
 |
Zinc finger Ran-binding domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Zranb2 PE=1 SV=2 |
| 602 | 25741 | tr|D3ZJU5|D3ZJU5_RAT | 53.76 | 1 | 1 | 1 | N | 120503 |  |
 |
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcc1 PE=1 SV=1 |
| 602 | 25742 | tr|A0A0G2K9D6|A0A0G2K9D6_RAT | 53.76 | 1 | 1 | 1 | N | 120953 | |
|
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcc1 PE=1 SV=1 |
| 602 | 25743 | tr|A0A8I6AMA8|A0A8I6AMA8_RAT | 53.76 | 1 | 1 | 1 | N | 122569 | |
|
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcc1 PE=3 SV=1 |
| 250 | 789 | E9PU28|IMDH2_RAT | 53.30 | 28 | 10 | 10 | Y | 55815 |  |
 |
Inosine-5'-monophosphate dehydrogenase 2 OS=Rattus norvegicus OX=10116 GN=Impdh2 PE=1 SV=1 |
| 1927 | 25117 | tr|D4ADF5|D4ADF5_RAT | 53.18 | 38 | 4 | 4 | N | 14204 |  |
 |
Programmed cell death 5 OS=Rattus norvegicus OX=10116 GN=Pdcd5 PE=1 SV=1 |
| 1356 | 24235 | tr|F7FF51|F7FF51_RAT | 52.40 | 20 | 4 | 4 | Y | 39209 |  |
 |
Serine/threonine-protein phosphatase 2A activator OS=Rattus norvegicus OX=10116 GN=Ptpa PE=1 SV=1 |
| 1463 | 24321 | tr|A0A8L2QLQ8|A0A8L2QLQ8_RAT | 52.23 | 2 | 1 | 1 | Y | 86292 |  |
 |
Amyloid-beta A4 protein OS=Rattus norvegicus OX=10116 GN=App PE=1 SV=1 |
| 1463 | 24320 | tr|A0A8I5Y8G9|A0A8I5Y8G9_RAT | 52.23 | 2 | 1 | 1 | Y | 84801 | |
|
Amyloid-beta A4 protein OS=Rattus norvegicus OX=10116 GN=App PE=1 SV=1 |
| 1463 | 24322 | P08592|A4_RAT | 52.23 | 2 | 1 | 1 | Y | 86704 | |
|
Amyloid-beta precursor protein OS=Rattus norvegicus OX=10116 GN=App PE=1 SV=2 |
| 1407 | 27536 | O54889|RPA1_RAT | 52.10 | 1 | 1 | 1 | Y | 194191 |  |
 |
DNA-directed RNA polymerase I subunit RPA1 OS=Rattus norvegicus OX=10116 GN=Polr1a PE=1 SV=1 |
| 2321 | 7495 | Q4KLF8|ARPC5_RAT | 51.06 | 31 | 2 | 2 | Y | 16320 |  |
 |
Actin-related protein 2/3 complex subunit 5 OS=Rattus norvegicus OX=10116 GN=Arpc5 PE=1 SV=3 |
| 232 | 565 | P50399|GDIB_RAT | 50.94 | 18 | 6 | 6 | Y | 50537 |  |
 |
Rab GDP dissociation inhibitor beta OS=Rattus norvegicus OX=10116 GN=Gdi2 PE=1 SV=2 |
| 477 | 1675 | Q5XI32|CAPZB_RAT | 50.76 | 39 | 9 | 9 | Y | 30629 |  |
 |
F-actin-capping protein subunit beta OS=Rattus norvegicus OX=10116 GN=Capzb PE=1 SV=1 |
| 259 | 593 | P47860|PFKAP_RAT | 50.65 | 2 | 1 | 1 | Y | 85720 |  |
 |
ATP-dependent 6-phosphofructokinase, platelet type OS=Rattus norvegicus OX=10116 GN=Pfkp PE=1 SV=2 |
| 259 | 22883 | tr|A0A8I5ZYA2|A0A8I5ZYA2_RAT | 50.65 | 2 | 1 | 1 | Y | 80431 | |
|
6-phosphofructokinase OS=Rattus norvegicus OX=10116 GN=Pfkp PE=1 SV=1 |
| 259 | 22887 | tr|A0A8I6B663|A0A8I6B663_RAT | 50.65 | 2 | 1 | 1 | Y | 85727 | |
|
ATP-dependent 6-phosphofructokinase OS=Rattus norvegicus OX=10116 GN=Pfkp PE=1 SV=1 |
| 414 | 716 | O09175|AMPB_RAT | 50.03 | 7 | 3 | 3 | Y | 72620 |  |
 |
Aminopeptidase B OS=Rattus norvegicus OX=10116 GN=Rnpep PE=1 SV=2 |
| 414 | 23024 | tr|G3V6V1|G3V6V1_RAT | 50.03 | 7 | 3 | 3 | Y | 72689 | |
|
Arginyl aminopeptidase OS=Rattus norvegicus OX=10116 GN=Rnpep PE=3 SV=1 |
| 74 | 22713 | tr|A0A8I6A0A2|A0A8I6A0A2_RAT | 49.81 | 3 | 6 | 6 | N | 293233 |  |
 |
Serine/arginine repetitive matrix 2 OS=Rattus norvegicus OX=10116 GN=Srrm2 PE=1 SV=1 |
| 579 | 26713 | tr|G3V661|G3V661_RAT | 49.29 | 2 | 2 | 2 | Y | 166740 |  |
|
Bromodomain adjacent to zinc finger domain, 1B OS=Rattus norvegicus OX=10116 GN=Baz1b PE=1 SV=2 |
| 579 | 26714 | tr|A0A8I6ALC2|A0A8I6ALC2_RAT | 49.29 | 2 | 2 | 2 | Y | 170290 | |
|
Bromodomain adjacent to zinc finger domain, 1B OS=Rattus norvegicus OX=10116 GN=Baz1b PE=4 SV=1 |
| 2355 | 43366 | tr|A0A0H2UHA6|A0A0H2UHA6_RAT | 49.21 | 5 | 1 | 1 | N | 27884 |  |
 |
Transmembrane protein 33 OS=Rattus norvegicus OX=10116 GN=Tmem33 PE=3 SV=1 |
| 2355 | 43367 | Q9Z142|TMM33_RAT | 49.21 | 5 | 1 | 1 | N | 27983 | |
|
Transmembrane protein 33 OS=Rattus norvegicus OX=10116 GN=Tmem33 PE=2 SV=1 |
| 2324 | 8338 | Q6PCT5|PQBP1_RAT | 49.21 | 17 | 2 | 2 | N | 30529 |  |
 |
Polyglutamine-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Pqbp1 PE=2 SV=1 |
| 992 | 25829 | tr|A0A8I5Y7K9|A0A8I5Y7K9_RAT | 49.18 | 4 | 2 | 2 | N | 77615 |  |
 |
Metadherin OS=Rattus norvegicus OX=10116 GN=Mtdh PE=4 SV=1 |
| 204 | 22921 | tr|D3Z941|D3Z941_RAT | 49.01 | 7 | 5 | 5 | Y | 101582 |  |
 |
Methionine--tRNA ligase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Mars1 PE=1 SV=1 |
| 2511 | 27279 | tr|A0A8I5ZP83|A0A8I5ZP83_RAT | 48.69 | 7 | 1 | 1 | N | 24936 |  |
 |
Charged multivesicular body protein 4B OS=Rattus norvegicus OX=10116 GN=Chmp4b PE=1 SV=1 |
| 2511 | 27280 | tr|D4A9Z8|D4A9Z8_RAT | 48.69 | 7 | 1 | 1 | N | 25109 | |
|
Chromatin modifying protein 4B-like 1 OS=Rattus norvegicus OX=10116 GN=Chmp4bl1 PE=3 SV=1 |
| 89 | 22848 | tr|Q6AYI1|Q6AYI1_RAT | 48.67 | 25 | 14 | 14 | Y | 69239 |  |
 |
Probable ATP-dependent RNA helicase DDX5 OS=Rattus norvegicus OX=10116 GN=Ddx5 PE=1 SV=1 |
| 89 | 22849 | tr|A0A8I5ZKV9|A0A8I5ZKV9_RAT | 48.67 | 25 | 14 | 14 | Y | 69411 | |
|
Probable ATP-dependent RNA helicase DDX5 OS=Rattus norvegicus OX=10116 GN=Ddx5 PE=1 SV=1 |
| 311 | 23146 | tr|G3V7L6|G3V7L6_RAT | 48.65 | 43 | 14 | 14 | Y | 48634 |  |
 |
26S proteasome regulatory subunit 7 OS=Rattus norvegicus OX=10116 GN=Psmc2 PE=3 SV=1 |
| 1544 | 4241 | A0JPM9|EIF3J_RAT | 48.26 | 14 | 3 | 3 | Y | 29187 |  |
 |
Eukaryotic translation initiation factor 3 subunit J OS=Rattus norvegicus OX=10116 GN=Eif3j PE=1 SV=1 |
| 1544 | 25618 | tr|A0A8L2QCM4|A0A8L2QCM4_RAT | 48.26 | 14 | 3 | 3 | Y | 27933 | |
|
Eukaryotic translation initiation factor 3 subunit J OS=Rattus norvegicus OX=10116 GN=Eif3j PE=1 SV=1 |
| 2309 | 25217 | tr|A0A8I5ZT02|A0A8I5ZT02_RAT | 48.18 | 3 | 1 | 1 | Y | 66720 |  |
 |
Syntaxin-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Stxbp2 PE=1 SV=1 |
| 2309 | 25216 | tr|A0A8I5ZVB0|A0A8I5ZVB0_RAT | 48.18 | 4 | 1 | 1 | Y | 63605 | |
|
Syntaxin-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Stxbp2 PE=1 SV=1 |
| 2309 | 3827 | Q62753|STXB2_RAT | 48.18 | 3 | 1 | 1 | Y | 66696 | |
|
Syntaxin-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Stxbp2 PE=2 SV=1 |
| 1304 | 3449 | P70580|PGRC1_RAT | 48.09 | 8 | 2 | 2 | N | 21598 |  |
 |
Membrane-associated progesterone receptor component 1 OS=Rattus norvegicus OX=10116 GN=Pgrmc1 PE=1 SV=3 |
| 1522 | 25698 | tr|Q5RKJ9|Q5RKJ9_RAT | 48.01 | 18 | 4 | 4 | N | 22541 |  |
 |
Ras-related protein Rab-10 OS=Rattus norvegicus OX=10116 GN=Rab10 PE=3 SV=1 |
| 332 | 25491 | tr|A0A8I6AL58|A0A8I6AL58_RAT | 47.60 | 2 | 2 | 2 | Y | 246089 |  |
 |
Ankyrin repeat domain 17 OS=Rattus norvegicus OX=10116 GN=Ankrd17 PE=1 SV=1 |
| 332 | 25499 | tr|A0A8I6AAR9|A0A8I6AAR9_RAT | 47.60 | 2 | 2 | 2 | Y | 276796 | |
|
Ankyrin repeat domain 17 OS=Rattus norvegicus OX=10116 GN=Ankrd17 PE=1 SV=1 |
| 332 | 25497 | tr|A0A0G2JVW3|A0A0G2JVW3_RAT | 47.60 | 2 | 2 | 2 | Y | 267310 | |
|
Ankyrin repeat domain 17 OS=Rattus norvegicus OX=10116 GN=Ankrd17 PE=1 SV=1 |
| 1984 | 28021 | tr|A0A8I6A5J2|A0A8I6A5J2_RAT | 47.15 | 3 | 1 | 1 | N | 67513 |  |
 |
Pre-mRNA 3'-end-processing factor FIP1 OS=Rattus norvegicus OX=10116 GN=Fip1l1 PE=1 SV=1 |
| 56 | 115 | Q5U300|UBA1_RAT | 47.14 | 14 | 10 | 10 | Y | 117788 |  |
 |
Ubiquitin-like modifier-activating enzyme 1 OS=Rattus norvegicus OX=10116 GN=Uba1 PE=1 SV=1 |
| 861 | 24880 | tr|Q7TQ90|Q7TQ90_RAT | 46.81 | 6 | 3 | 3 | Y | 93847 |  |
 |
Alcohol dehydrogenase class-3 OS=Rattus norvegicus OX=10116 GN=Adh4 PE=1 SV=1 |
| 39 | 22745 | tr|D3ZU13|D3ZU13_RAT | 46.49 | 8 | 10 | 10 | N | 175704 |  |
 |
Eukaryotic translation initiation factor 4 gamma 1 OS=Rattus norvegicus OX=10116 GN=Eif4g1 PE=1 SV=1 |
| 39 | 22746 | tr|D4AD15|D4AD15_RAT | 46.49 | 8 | 10 | 10 | N | 179472 | |
|
Eukaryotic translation initiation factor 4 gamma 1 OS=Rattus norvegicus OX=10116 GN=Eif4g1 PE=1 SV=3 |
| 39 | 22747 | tr|M0RD03|M0RD03_RAT | 46.49 | 8 | 10 | 10 | N | 180218 | |
|
Eukaryotic translation initiation factor 4 gamma 1 OS=Rattus norvegicus OX=10116 GN=Eif4g1 PE=1 SV=2 |
| 756 | 24098 | tr|A0A8L2QJE6|A0A8L2QJE6_RAT | 46.01 | 14 | 3 | 3 | Y | 34939 |  |
 |
Omega-amidase NIT2 OS=Rattus norvegicus OX=10116 GN=Nit2 PE=1 SV=1 |
| 1074 | 29236 | tr|F1MA04|F1MA04_RAT | 45.96 | 2 | 1 | 1 | N | 99408 |  |
 |
WD repeat domain 36 OS=Rattus norvegicus OX=10116 GN=Wdr36 PE=1 SV=4 |
| 1074 | 61078 | tr|A0A8I6A876|A0A8I6A876_RAT | 45.96 | 2 | 1 | 1 | N | 94833 | |
|
WD repeat domain 36 OS=Rattus norvegicus OX=10116 GN=Wdr36 PE=1 SV=1 |
| 269 | 25259 | tr|D3ZD89|D3ZD89_RAT | 45.83 | 9 | 5 | 5 | Y | 101010 |  |
 |
N(alpha)-acetyltransferase 15, NatA auxiliary subunit OS=Rattus norvegicus OX=10116 GN=Naa15 PE=1 SV=2 |
| 2111 | 27133 | tr|A0A8I5ZMG4|A0A8I5ZMG4_RAT | 45.82 | 9 | 2 | 2 | N | 28299 |  |
|
Thioredoxin-dependent peroxide reductase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Prdx3 PE=3 SV=1 |
| 2111 | 27134 | tr|A0A8I6A0U2|A0A8I6A0U2_RAT | 45.82 | 9 | 2 | 2 | N | 29789 | |
|
Thioredoxin-dependent peroxide reductase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Prdx3 PE=1 SV=1 |
| 640 | 24270 | tr|Q4V8I9|Q4V8I9_RAT | 45.76 | 8 | 3 | 3 | N | 57023 |  |
 |
UTP--glucose-1-phosphate uridylyltransferase OS=Rattus norvegicus OX=10116 GN=Ugp2 PE=1 SV=1 |
| 640 | 24271 | tr|A0A0G2K542|A0A0G2K542_RAT | 45.76 | 8 | 3 | 3 | N | 56997 | |
|
UTP--glucose-1-phosphate uridylyltransferase OS=Rattus norvegicus OX=10116 GN=Ugp2 PE=1 SV=2 |
| 640 | 24272 | tr|A0A8I6G7V9|A0A8I6G7V9_RAT | 45.76 | 8 | 3 | 3 | N | 57045 | |
|
UTP--glucose-1-phosphate uridylyltransferase OS=Rattus norvegicus OX=10116 GN=Ugp2 PE=1 SV=1 |
| 2851 | 7677 | Q5BJP3|UFM1_RAT | 45.74 | 18 | 1 | 1 | N | 9118 |  |
 |
Ubiquitin-fold modifier 1 OS=Rattus norvegicus OX=10116 GN=Ufm1 PE=3 SV=1 |
| 588 | 2001 | Q63355|MYO1C_RAT | 45.64 | 2 | 2 | 2 | N | 119811 |  |
 |
Unconventional myosin-Ic OS=Rattus norvegicus OX=10116 GN=Myo1c PE=1 SV=2 |
| 398 | 22994 | tr|D3ZJH9|D3ZJH9_RAT | 45.53 | 7 | 3 | 3 | N | 65352 |  |
 |
Malic enzyme OS=Rattus norvegicus OX=10116 GN=Me2 PE=1 SV=1 |
| 398 | 22996 | tr|A0A0G2K502|A0A0G2K502_RAT | 45.53 | 7 | 3 | 3 | N | 66310 | |
|
Malic enzyme OS=Rattus norvegicus OX=10116 GN=Me2 PE=1 SV=1 |
| 778 | 41829 | Q2A121|FTO_RAT | 45.24 | 5 | 2 | 2 | Y | 57972 |  |
 |
Alpha-ketoglutarate-dependent dioxygenase FTO OS=Rattus norvegicus OX=10116 GN=Fto PE=2 SV=1 |
| 778 | 41830 | tr|A0A0G2K675|A0A0G2K675_RAT | 45.24 | 5 | 2 | 2 | Y | 59082 | |
|
Alpha-ketoglutarate-dependent dioxygenase FTO OS=Rattus norvegicus OX=10116 GN=Fto PE=1 SV=1 |
| 1673 | 60918 | Q80W92|VAC14_RAT | 45.13 | 2 | 1 | 1 | N | 88068 |  |
 |
Protein VAC14 homolog OS=Rattus norvegicus OX=10116 GN=Vac14 PE=1 SV=1 |
| 2185 | 27164 | tr|A0A8I6GJ49|A0A8I6GJ49_RAT | 45.11 | 26 | 4 | 4 | Y | 16272 |  |
 |
Eukaryotic translation initiation factor 4C OS=Rattus norvegicus OX=10116 GN=Eif1ax PE=1 SV=1 |
| 2185 | 27165 | tr|A0A8I6A8I7|A0A8I6A8I7_RAT | 45.11 | 25 | 4 | 4 | Y | 16676 | |
|
Eukaryotic translation initiation factor 4C OS=Rattus norvegicus OX=10116 GN=Eif1ax PE=1 SV=1 |
| 1181 | 4272 | Q5XIT9|MCCB_RAT | 44.97 | 6 | 2 | 2 | Y | 61517 |  |
 |
Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Rattus norvegicus OX=10116 GN=Mccc2 PE=2 SV=1 |
| 1181 | 25549 | tr|A0A8I6A3M2|A0A8I6A3M2_RAT | 44.97 | 6 | 2 | 2 | Y | 56282 | |
|
methylcrotonoyl-CoA carboxylase OS=Rattus norvegicus OX=10116 GN=Mccc2 PE=1 SV=1 |
| 1681 | 27299 | tr|A0A8I6AFM7|A0A8I6AFM7_RAT | 44.79 | 2 | 1 | 1 | N | 103641 |  |
 |
SCY1 like pseudokinase 2 OS=Rattus norvegicus OX=10116 GN=Scyl2 PE=1 SV=1 |
| 405 | 1784 | P09495|TPM4_RAT | 44.59 | 17 | 3 | 3 | Y | 28510 |  |
 |
Tropomyosin alpha-4 chain OS=Rattus norvegicus OX=10116 GN=Tpm4 PE=1 SV=3 |
| 2396 | 61112 | tr|G3V818|G3V818_RAT | 44.39 | 4 | 1 | 1 | N | 42322 |  |
 |
Parvin, alpha OS=Rattus norvegicus OX=10116 GN=Parva PE=1 SV=1 |
| 1943 | 61238 | tr|A0A8I6GAM2|A0A8I6GAM2_RAT | 44.37 | 8 | 1 | 1 | N | 24497 |  |
 |
Small nuclear ribonucleoprotein polypeptide B2 OS=Rattus norvegicus OX=10116 GN=Snrpb2 PE=1 SV=1 |
| 1305 | 7172 | Q91V33|KHDR1_RAT | 44.19 | 3 | 1 | 1 | N | 48315 |  |
 |
KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Khdrbs1 PE=1 SV=1 |
| 517 | 1658 | P04961|PCNA_RAT | 44.05 | 44 | 9 | 9 | Y | 28749 |  |
 |
Proliferating cell nuclear antigen OS=Rattus norvegicus OX=10116 GN=Pcna PE=1 SV=1 |
| 439 | 3857 | Q04931|SSRP1_RAT | 43.98 | 14 | 8 | 8 | Y | 80915 |  |
 |
FACT complex subunit SSRP1 OS=Rattus norvegicus OX=10116 GN=Ssrp1 PE=1 SV=2 |
| 439 | 25162 | tr|A0A8L2R8I0|A0A8L2R8I0_RAT | 43.98 | 13 | 8 | 8 | Y | 91414 | |
|
FACT complex subunit SSRP1 OS=Rattus norvegicus OX=10116 GN=Ssrp1 PE=1 SV=1 |
| 439 | 25164 | tr|A0A8L2Q6E8|A0A8L2Q6E8_RAT | 43.98 | 13 | 8 | 8 | Y | 91660 | |
|
FACT complex subunit SSRP1 OS=Rattus norvegicus OX=10116 GN=Ssrp1 PE=1 SV=1 |
| 156 | 23083 | tr|G3V681|G3V681_RAT | 43.84 | 2 | 1 | 1 | N | 96571 |  |
 |
DNA replication licensing factor MCM4 OS=Rattus norvegicus OX=10116 GN=Mcm4 PE=1 SV=1 |
| 1495 | 61596 | tr|D3ZKG1|D3ZKG1_RAT | 43.62 | 2 | 1 | 1 | N | 92036 |  |
 |
Methylmalonyl-CoA mutase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Mmut PE=1 SV=2 |
| 1495 | 61595 | tr|A0A8I6A0B2|A0A8I6A0B2_RAT | 43.62 | 2 | 1 | 1 | N | 85947 | |
|
Methylmalonyl-CoA mutase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Mmut PE=1 SV=1 |
| 906 | 2244 | P24268|CATD_RAT | 43.00 | 4 | 1 | 1 | Y | 44681 |  |
 |
Cathepsin D OS=Rattus norvegicus OX=10116 GN=Ctsd PE=1 SV=1 |
| 906 | 24060 | tr|F7F3R8|F7F3R8_RAT | 43.00 | 4 | 1 | 1 | Y | 44423 | |
|
Cathepsin D OS=Rattus norvegicus OX=10116 GN=Ctsd PE=1 SV=1 |
| 906 | 24061 | tr|A6HY44|A6HY44_RAT | 43.00 | 4 | 1 | 1 | Y | 44623 | |
|
Cathepsin D OS=Rattus norvegicus OX=10116 GN=Ctsd PE=1 SV=1 |
| 1290 | 61056 | tr|A0A0G2JXU1|A0A0G2JXU1_RAT | 42.75 | 2 | 1 | 1 | N | 91780 |  |
 |
Nuclear VCP-like OS=Rattus norvegicus OX=10116 GN=Nvl PE=1 SV=2 |
| 1290 | 61057 | tr|D3ZTY9|D3ZTY9_RAT | 42.75 | 2 | 1 | 1 | N | 94447 | |
|
Nuclear VCP-like OS=Rattus norvegicus OX=10116 GN=Nvl PE=1 SV=1 |
| 1711 | 5495 | P39069|KAD1_RAT | 42.59 | 13 | 2 | 2 | N | 21584 |  |
 |
Adenylate kinase isoenzyme 1 OS=Rattus norvegicus OX=10116 GN=Ak1 PE=1 SV=3 |
| 1711 | 26197 | tr|M0RC66|M0RC66_RAT | 42.59 | 12 | 2 | 2 | N | 23219 | |
|
Adenylate kinase isoenzyme 1 OS=Rattus norvegicus OX=10116 GN=Ak1 PE=3 SV=3 |
| 1554 | 26273 | tr|A0A8I5YBZ5|A0A8I5YBZ5_RAT | 42.55 | 12 | 2 | 2 | N | 31401 |  |
 |
Calponin OS=Rattus norvegicus OX=10116 GN=Cnn3 PE=1 SV=1 |
| 1554 | 5131 | P37397|CNN3_RAT | 42.55 | 10 | 2 | 2 | N | 36435 | |
|
Calponin-3 OS=Rattus norvegicus OX=10116 GN=Cnn3 PE=1 SV=1 |
| 623 | 1017 | B0BN85|SGT1_RAT | 42.22 | 14 | 3 | 3 | N | 38091 |  |
 |
Protein SGT1 homolog OS=Rattus norvegicus OX=10116 GN=Sugt1 PE=2 SV=1 |
| 221 | 515 | P24155|THOP1_RAT | 42.20 | 7 | 4 | 4 | Y | 78386 |  |
 |
Thimet oligopeptidase OS=Rattus norvegicus OX=10116 GN=Thop1 PE=1 SV=4 |
| 1868 | 41967 | tr|Q6P2A5|Q6P2A5_RAT | 42.13 | 7 | 1 | 1 | N | 25494 |  |
 |
GTP:AMP phosphotransferase AK3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ak3 PE=3 SV=1 |
| 1012 | 3427 | P84079|ARF1_RAT | 41.87 | 20 | 3 | 3 | Y | 20697 |  |
 |
ADP-ribosylation factor 1 OS=Rattus norvegicus OX=10116 GN=Arf1 PE=1 SV=2 |
| 2493 | 6465 | O35264|PA1B2_RAT | 41.70 | 22 | 3 | 3 | Y | 25581 |  |
 |
Platelet-activating factor acetylhydrolase IB subunit alpha2 OS=Rattus norvegicus OX=10116 GN=Pafah1b2 PE=1 SV=1 |
| 1506 | 25790 | tr|G3V7L8|G3V7L8_RAT | 41.46 | 6 | 1 | 1 | N | 26143 |  |
 |
V-type proton ATPase subunit E 1 OS=Rattus norvegicus OX=10116 GN=Atp6v1e1 PE=3 SV=1 |
| 2809 | 42155 | tr|A0A8I6ACK1|A0A8I6ACK1_RAT | 40.24 | 8 | 1 | 1 | Y | 26591 |  |
 |
Dynactin subunit 3 OS=Rattus norvegicus OX=10116 GN=Dctn3 PE=1 SV=1 |
| 2809 | 42154 | tr|A0A8I6AIV4|A0A8I6AIV4_RAT | 40.24 | 11 | 1 | 1 | Y | 21030 | |
|
Dynactin 3-like 1 OS=Rattus norvegicus OX=10116 GN=Dctn3l1 PE=1 SV=1 |
| 337 | 864 | Q5U216|DX39A_RAT | 40.14 | 7 | 3 | 3 | Y | 49110 |  |
 |
ATP-dependent RNA helicase DDX39A OS=Rattus norvegicus OX=10116 GN=Ddx39a PE=2 SV=1 |
| 337 | 23159 | tr|A0A8I5ZVU6|A0A8I5ZVU6_RAT | 40.14 | 7 | 3 | 3 | Y | 51174 | |
|
RNA helicase OS=Rattus norvegicus OX=10116 GN=Ddx39a PE=1 SV=1 |
| 337 | 23158 | tr|A0A8I6A2E4|A0A8I6A2E4_RAT | 40.14 | 7 | 3 | 3 | Y | 50516 | |
|
RNA helicase OS=Rattus norvegicus OX=10116 GN=Ddx39a PE=1 SV=1 |
| 1550 | 24955 | tr|A0A8I6AR73|A0A8I6AR73_RAT | 40.12 | 3 | 1 | 1 | N | 55245 |  |
 |
Prenylcysteine oxidase 1 OS=Rattus norvegicus OX=10116 GN=Pcyox1 PE=1 SV=1 |
| 1550 | 24956 | Q99ML5|PCYOX_RAT | 40.12 | 3 | 1 | 1 | N | 56288 | |
|
Prenylcysteine oxidase 1 OS=Rattus norvegicus OX=10116 GN=Pcyox1 PE=1 SV=1 |
| 1701 | 28941 | tr|D3ZXS8|D3ZXS8_RAT | 39.82 | 27 | 3 | 3 | N | 15810 |  |
 |
E2 ubiquitin-conjugating enzyme OS=Rattus norvegicus OX=10116 GN=Ube2k PE=4 SV=2 |
| 1392 | 3546 | P07872|ACOX1_RAT | 39.77 | 3 | 1 | 1 | N | 74679 |  |
 |
Peroxisomal acyl-coenzyme A oxidase 1 OS=Rattus norvegicus OX=10116 GN=Acox1 PE=1 SV=1 |
| 1392 | 24950 | tr|F1LQC1|F1LQC1_RAT | 39.77 | 3 | 1 | 1 | N | 74509 | |
|
Acyl-coenzyme A oxidase OS=Rattus norvegicus OX=10116 GN=Acox1 PE=1 SV=3 |
| 1908 | 27306 | tr|A0A8I6AL51|A0A8I6AL51_RAT | 39.37 | 3 | 1 | 1 | Y | 51980 |  |
 |
CUGBP, Elav-like family member 1 OS=Rattus norvegicus OX=10116 GN=Celf1 PE=1 SV=1 |
| 1908 | 42463 | tr|A0A8L2Q6U8|A0A8L2Q6U8_RAT | 39.37 | 3 | 1 | 1 | Y | 51688 | |
|
CUGBP, Elav-like family member 1 OS=Rattus norvegicus OX=10116 GN=Celf1 PE=1 SV=1 |
| 1908 | 42464 | tr|A0A8I5ZTX3|A0A8I5ZTX3_RAT | 39.37 | 3 | 1 | 1 | Y | 52059 | |
|
CUGBP, Elav-like family member 1 OS=Rattus norvegicus OX=10116 GN=Celf1 PE=1 SV=1 |
| 1908 | 42465 | Q4QQT3|CELF1_RAT | 39.37 | 3 | 1 | 1 | Y | 52205 | |
|
CUGBP Elav-like family member 1 OS=Rattus norvegicus OX=10116 GN=Celf1 PE=2 SV=1 |
| 1338 | 42236 | tr|A0A8I5ZNN2|A0A8I5ZNN2_RAT | 39.34 | 2 | 1 | 1 | N | 82269 |  |
 |
TLE family member 3, transcriptional corepressor OS=Rattus norvegicus OX=10116 GN=Tle3 PE=1 SV=1 |
| 1338 | 42235 | tr|A0A8L2QA95|A0A8L2QA95_RAT | 39.34 | 2 | 1 | 1 | N | 81519 | |
|
TLE family member 3, transcriptional corepressor OS=Rattus norvegicus OX=10116 GN=Tle3 PE=1 SV=1 |
| 1338 | 42233 | tr|A0A8I6A1Z7|A0A8I6A1Z7_RAT | 39.34 | 2 | 1 | 1 | N | 75735 | |
|
TLE family member 3, transcriptional corepressor OS=Rattus norvegicus OX=10116 GN=Tle3 PE=1 SV=1 |
| 1338 | 42234 | tr|A0A8I6AEG3|A0A8I6AEG3_RAT | 39.34 | 2 | 1 | 1 | N | 80670 | |
|
TLE family member 3, transcriptional corepressor OS=Rattus norvegicus OX=10116 GN=Tle3 PE=1 SV=1 |
| 1338 | 42237 | Q9JIT3|TLE3_RAT | 39.34 | 2 | 1 | 1 | N | 82644 | |
|
Transducin-like enhancer protein 3 OS=Rattus norvegicus OX=10116 GN=Tle3 PE=1 SV=1 |
| 1497 | 2819 | Q5FVQ4|MLEC_RAT | 39.34 | 16 | 4 | 4 | Y | 32418 |  |
 |
Malectin OS=Rattus norvegicus OX=10116 GN=Mlec PE=2 SV=1 |
| 761 | 1259 | P63086|MK01_RAT | 39.27 | 13 | 2 | 2 | N | 41276 |  |
 |
Mitogen-activated protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Mapk1 PE=1 SV=3 |
| 2145 | 27555 | tr|A0A0U1RRV7|A0A0U1RRV7_RAT | 38.77 | 5 | 1 | 1 | N | 21321 |  |
 |
Serine and arginine rich splicing factor 3 OS=Rattus norvegicus OX=10116 GN=Srsf3 PE=3 SV=2 |
| 2145 | 27556 | tr|A0A8I6A2P1|A0A8I6A2P1_RAT | 38.77 | 4 | 1 | 1 | N | 24461 | |
|
Serine and arginine rich splicing factor 3 OS=Rattus norvegicus OX=10116 GN=Srsf3 PE=3 SV=1 |
| 2145 | 27553 | tr|A0A8I6A2L6|A0A8I6A2L6_RAT | 38.77 | 7 | 1 | 1 | N | 14203 | |
|
Serine and arginine rich splicing factor 3 OS=Rattus norvegicus OX=10116 GN=Srsf3 PE=3 SV=1 |
| 2145 | 27554 | tr|A0A8I5ZSN8|A0A8I5ZSN8_RAT | 38.77 | 7 | 1 | 1 | N | 14518 | |
|
RRM domain-containing protein OS=Rattus norvegicus OX=10116 GN=AABR07026797.1 PE=3 SV=1 |
| 1500 | 3671 | Q9Z269|VAPB_RAT | 38.64 | 6 | 1 | 1 | N | 26916 |  |
 |
Vesicle-associated membrane protein-associated protein B OS=Rattus norvegicus OX=10116 GN=Vapb PE=1 SV=3 |
| 1644 | 24965 | tr|A0A8I6A6U3|A0A8I6A6U3_RAT | 38.05 | 3 | 1 | 1 | N | 56000 |  |
 |
Sorting nexin 1 OS=Rattus norvegicus OX=10116 GN=Snx1 PE=1 SV=1 |
| 1644 | 3641 | Q99N27|SNX1_RAT | 38.05 | 3 | 1 | 1 | N | 59044 | |
|
Sorting nexin-1 OS=Rattus norvegicus OX=10116 GN=Snx1 PE=1 SV=1 |
| 1644 | 24964 | tr|A0A8I5Y518|A0A8I5Y518_RAT | 38.05 | 3 | 1 | 1 | N | 54664 | |
|
Sorting nexin-1 OS=Rattus norvegicus OX=10116 GN=Snx1 PE=1 SV=1 |
| 492 | 23530 | tr|Q6P6T9|Q6P6T9_RAT | 37.98 | 3 | 1 | 1 | N | 57837 |  |
 |
Importin subunit alpha OS=Rattus norvegicus OX=10116 GN=Kpna2 PE=1 SV=1 |
| 1207 | 28336 | tr|A0A8I5ZLF3|A0A8I5ZLF3_RAT | 37.95 | 3 | 1 | 1 | Y | 86333 |  |
 |
AFG3 like matrix AAA peptidase subunit 2 OS=Rattus norvegicus OX=10116 GN=Afg3l2 PE=1 SV=1 |
| 1207 | 28337 | tr|F1LN92|F1LN92_RAT | 37.95 | 3 | 1 | 1 | Y | 89352 | |
|
AFG3 like matrix AAA peptidase subunit 2 OS=Rattus norvegicus OX=10116 GN=Afg3l2 PE=1 SV=1 |
| 2247 | 42118 | P62775|MTPN_RAT | 37.81 | 8 | 1 | 1 | Y | 12861 |  |
 |
Myotrophin OS=Rattus norvegicus OX=10116 GN=Mtpn PE=1 SV=2 |
| 739 | 26354 | tr|D4A8G7|D4A8G7_RAT | 37.38 | 14 | 4 | 4 | N | 61464 |  |
 |
SNW domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Snw1 PE=1 SV=1 |
| 739 | 26355 | tr|A0A8I5ZP60|A0A8I5ZP60_RAT | 37.38 | 14 | 4 | 4 | N | 61464 | |
|
SNW domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Snw1 PE=1 SV=1 |
| 2203 | 81276 | tr|A0A8L2R5B0|A0A8L2R5B0_RAT | 36.67 | 14 | 3 | 3 | N | 24993 |  |
 |
MOB kinase activator 1A OS=Rattus norvegicus OX=10116 GN=Mob1a PE=1 SV=1 |
| 2203 | 42328 | tr|D4A1V7|D4A1V7_RAT | 36.67 | 14 | 3 | 3 | N | 25349 | |
|
MOB kinase activator 1B OS=Rattus norvegicus OX=10116 GN=Mob1b PE=4 SV=2 |
| 2203 | 42329 | tr|A0A8I5YCB8|A0A8I5YCB8_RAT | 36.67 | 13 | 3 | 3 | N | 26494 | |
|
MOB kinase activator 1B OS=Rattus norvegicus OX=10116 GN=Mob1b PE=1 SV=1 |
| 2203 | 42867 | tr|A0A8I6AAQ1|A0A8I6AAQ1_RAT | 36.67 | 9 | 2 | 2 | N | 24758 |  |
 |
MOB kinase activator 1B OS=Rattus norvegicus OX=10116 GN=Mob1b PE=1 SV=1 |
| 2203 | 100473 | Q3T1J9|MOB1A_RAT | 36.67 | 14 | 3 | 3 | N | 25080 | |
|
MOB kinase activator 1A OS=Rattus norvegicus OX=10116 GN=Mob1a PE=2 SV=3 |
| 2203 | 100474 | tr|A0A8I5ZK61|A0A8I5ZK61_RAT | 36.67 | 14 | 3 | 3 | N | 25112 | |
|
MOB kinase activator 1A, pseudogene 1 OS=Rattus norvegicus OX=10116 GN=Mob1a PE=4 SV=1 |
| 344 | 406 | P30835|PFKAL_RAT | 36.40 | 4 | 2 | 2 | N | 85339 |  |
 |
ATP-dependent 6-phosphofructokinase, liver type OS=Rattus norvegicus OX=10116 GN=Pfkl PE=1 SV=3 |
| 1872 | 3397 | Q5I0D7|PEPD_RAT | 35.97 | 5 | 2 | 2 | Y | 54751 |  |
 |
Xaa-Pro dipeptidase OS=Rattus norvegicus OX=10116 GN=Pepd PE=2 SV=1 |
| 1197 | 41904 | Q3KR59|UBP10_RAT | 35.95 | 6 | 3 | 3 | N | 87311 |  |
 |
Ubiquitin carboxyl-terminal hydrolase 10 OS=Rattus norvegicus OX=10116 GN=Usp10 PE=1 SV=1 |
| 1197 | 41905 | tr|A0A8L2QBF0|A0A8L2QBF0_RAT | 35.95 | 6 | 3 | 3 | N | 87362 | |
|
Ubiquitin carboxyl-terminal hydrolase OS=Rattus norvegicus OX=10116 GN=Usp10 PE=1 SV=1 |
| 1417 | 31356 | tr|A0A8I6G3Z5|A0A8I6G3Z5_RAT | 35.79 | 2 | 2 | 2 | N | 155670 |  |
 |
Mediator of RNA polymerase II transcription subunit 23 OS=Rattus norvegicus OX=10116 GN=Med23 PE=3 SV=1 |
| 1417 | 31357 | tr|A0A0H2UHV2|A0A0H2UHV2_RAT | 35.79 | 2 | 2 | 2 | N | 156558 | |
|
Mediator of RNA polymerase II transcription subunit 23 OS=Rattus norvegicus OX=10116 GN=Med23 PE=3 SV=1 |
| 1417 | 81299 | tr|A0A8I6A9J3|A0A8I6A9J3_RAT | 35.79 | 2 | 2 | 2 | N | 157199 | |
|
Mediator of RNA polymerase II transcription subunit 23 OS=Rattus norvegicus OX=10116 GN=Med23 PE=3 SV=1 |
| 1417 | 81298 | Q5EB59|MED23_RAT | 35.79 | 2 | 2 | 2 | N | 156231 | |
|
Mediator of RNA polymerase II transcription subunit 23 OS=Rattus norvegicus OX=10116 GN=Med23 PE=2 SV=2 |
| 321 | 29760 | tr|F7FMJ3|F7FMJ3_RAT | 35.42 | 3 | 1 | 1 | N | 88723 |  |
 |
Cullin 1 OS=Rattus norvegicus OX=10116 GN=Cul1 PE=1 SV=1 |
| 1502 | 5098 | P83953|IMA5_RAT | 35.23 | 4 | 1 | 1 | N | 60137 |  |
 |
Importin subunit alpha-5 OS=Rattus norvegicus OX=10116 GN=Kpna1 PE=1 SV=1 |
| 1502 | 26051 | tr|Q56R20|Q56R20_RAT | 35.23 | 4 | 1 | 1 | N | 60197 | |
|
Importin subunit alpha OS=Rattus norvegicus OX=10116 GN=Kpna1 PE=3 SV=1 |
| 1502 | 26052 | tr|A0A0G2K0T0|A0A0G2K0T0_RAT | 35.23 | 3 | 1 | 1 | N | 60864 | |
|
Importin subunit alpha OS=Rattus norvegicus OX=10116 GN=Kpna1 PE=1 SV=1 |
| 1502 | 26053 | tr|A0A8I6AKK8|A0A8I6AKK8_RAT | 35.23 | 3 | 1 | 1 | N | 61399 | |
|
Importin subunit alpha OS=Rattus norvegicus OX=10116 GN=Kpna1 PE=1 SV=1 |
| 228 | 1432 | F1LP64|TRIPC_RAT | 34.87 | 4 | 5 | 5 | N | 223926 |  |
 |
E3 ubiquitin-protein ligase TRIP12 OS=Rattus norvegicus OX=10116 GN=Trip12 PE=1 SV=1 |
| 2055 | 42226 | B1H267|SNX5_RAT | 34.86 | 7 | 2 | 2 | Y | 46793 |  |
 |
Sorting nexin-5 OS=Rattus norvegicus OX=10116 GN=Snx5 PE=1 SV=1 |
| 2055 | 42225 | tr|A0A8L2Q3Z7|A0A8L2Q3Z7_RAT | 34.86 | 8 | 2 | 2 | Y | 44410 | |
|
Sorting nexin 5 OS=Rattus norvegicus OX=10116 GN=Snx5 PE=1 SV=1 |
| 501 | 25145 | tr|E9PSJ4|E9PSJ4_RAT | 34.64 | 2 | 2 | 2 | N | 146442 |  |
 |
Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=3 |
| 501 | 25147 | tr|A0A0G2K6E8|A0A0G2K6E8_RAT | 34.64 | 2 | 2 | 2 | N | 149585 | |
|
Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1 |
| 1237 | 25330 | tr|A0A8I6A953|A0A8I6A953_RAT | 34.12 | 2 | 2 | 2 | Y | 101957 |  |
 |
Calcium homeostasis endoplasmic reticulum protein OS=Rattus norvegicus OX=10116 GN=Cherp PE=1 SV=1 |
| 1237 | 25332 | tr|D3ZAX5|D3ZAX5_RAT | 34.12 | 2 | 2 | 2 | Y | 107180 | |
|
Calcium homeostasis endoplasmic reticulum protein OS=Rattus norvegicus OX=10116 GN=Cherp PE=1 SV=3 |
| 1237 | 25331 | tr|A0A8I5ZN65|A0A8I5ZN65_RAT | 34.12 | 2 | 2 | 2 | Y | 105212 | |
|
Calcium homeostasis endoplasmic reticulum protein OS=Rattus norvegicus OX=10116 GN=Cherp PE=1 SV=1 |
| 651 | 25130 | tr|A0A8I6ARM9|A0A8I6ARM9_RAT | 34.11 | 2 | 1 | 1 | N | 93223 |  |
 |
GRIP1 associated protein 1 OS=Rattus norvegicus OX=10116 GN=Gripap1 PE=1 SV=1 |
| 935 | 32256 | tr|A0A8I6A3Y7|A0A8I6A3Y7_RAT | 34.06 | 2 | 1 | 1 | N | 73982 |  |
 |
Nucleolar GTP-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gtpbp4 PE=1 SV=1 |
| 935 | 32254 | tr|A0A8I6ADM2|A0A8I6ADM2_RAT | 34.06 | 2 | 1 | 1 | N | 72112 | |
|
Nucleolar GTP-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gtpbp4 PE=1 SV=1 |
| 935 | 32257 | tr|M0R623|M0R623_RAT | 34.06 | 2 | 1 | 1 | N | 74152 | |
|
Nucleolar GTP-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gtpbp4 PE=1 SV=2 |
| 935 | 33706 | tr|A0A8I6A3N8|A0A8I6A3N8_RAT | 34.06 | 2 | 1 | 1 | N | 71619 | |
|
Nucleolar GTP-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gtpbp4 PE=1 SV=1 |
| 1612 | 26457 | P21913|SDHB_RAT | 33.96 | 4 | 1 | 1 | N | 31830 |  |
 |
Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sdhb PE=2 SV=2 |
| 877 | 26813 | tr|A0A8I6A183|A0A8I6A183_RAT | 33.84 | 1 | 1 | 1 | N | 130874 |  |
 |
Cell division cycle and apoptosis regulator 1 OS=Rattus norvegicus OX=10116 GN=Ccar1 PE=1 SV=1 |
| 877 | 26814 | tr|D4A2P1|D4A2P1_RAT | 33.84 | 1 | 1 | 1 | N | 133101 | |
|
Cell division cycle and apoptosis regulator 1 OS=Rattus norvegicus OX=10116 GN=Ccar1 PE=1 SV=3 |
| 564 | 24132 | tr|D4A994|D4A994_RAT | 33.69 | 5 | 4 | 4 | N | 111185 |  |
 |
ER membrane protein complex subunit 1 OS=Rattus norvegicus OX=10116 GN=Emc1 PE=1 SV=1 |
| 564 | 24133 | tr|A0A8I5ZYA8|A0A8I5ZYA8_RAT | 33.69 | 5 | 4 | 4 | N | 111497 | |
|
ER membrane protein complex subunit 1 OS=Rattus norvegicus OX=10116 GN=Emc1 PE=1 SV=1 |
| 1229 | 2905 | Q91Y78|UCHL3_RAT | 33.65 | 15 | 2 | 2 | Y | 26124 |  |
 |
Ubiquitin carboxyl-terminal hydrolase isozyme L3 OS=Rattus norvegicus OX=10116 GN=Uchl3 PE=1 SV=1 |
| 1631 | 6860 | O35964|SH3G1_RAT | 33.47 | 5 | 1 | 1 | N | 41492 |  |
 |
Endophilin-A2 OS=Rattus norvegicus OX=10116 GN=Sh3gl1 PE=1 SV=1 |
| 1631 | 26655 | tr|A0A8I6AHS1|A0A8I6AHS1_RAT | 33.47 | 5 | 1 | 1 | N | 43245 | |
|
Endophilin-A2 OS=Rattus norvegicus OX=10116 GN=Sh3gl1 PE=1 SV=1 |
| 1631 | 26657 | tr|A0A8I6A0Q5|A0A8I6A0Q5_RAT | 33.47 | 4 | 1 | 1 | N | 52913 | |
|
Endophilin-A2 OS=Rattus norvegicus OX=10116 GN=Sh3gl1 PE=1 SV=1 |
| 1631 | 26654 | tr|A0A8I5YC58|A0A8I5YC58_RAT | 33.47 | 5 | 1 | 1 | N | 41465 | |
|
Endophilin-A2 OS=Rattus norvegicus OX=10116 GN=Sh3gl1 PE=1 SV=1 |
| 1000 | 4794 | Q01986|MP2K1_RAT | 33.37 | 3 | 1 | 1 | N | 43465 |  |
 |
Dual specificity mitogen-activated protein kinase kinase 1 OS=Rattus norvegicus OX=10116 GN=Map2k1 PE=1 SV=2 |
| 1963 | 42229 | tr|A0A8I5ZZ43|A0A8I5ZZ43_RAT | 33.15 | 2 | 1 | 1 | N | 50137 |  |
 |
Endophilin-B2 OS=Rattus norvegicus OX=10116 GN=Sh3glb2 PE=1 SV=1 |
| 699 | 34988 | tr|A0A0U1RRZ3|A0A0U1RRZ3_RAT | 32.88 | 2 | 1 | 1 | N | 88420 |  |
 |
NFKB repressing factor OS=Rattus norvegicus OX=10116 GN=Nkrf PE=3 SV=3 |
| 1962 | 29250 | Q5PQQ2|WBP11_RAT | 32.83 | 2 | 1 | 1 | N | 69996 |  |
 |
WW domain-binding protein 11 OS=Rattus norvegicus OX=10116 GN=Wbp11 PE=1 SV=1 |
| 2098 | 6397 | Q8CFN2|CDC42_RAT | 32.76 | 6 | 1 | 1 | Y | 21259 |  |
 |
Cell division control protein 42 homolog OS=Rattus norvegicus OX=10116 GN=Cdc42 PE=1 SV=2 |
| 1555 | 27503 | tr|B2GV41|B2GV41_RAT | 32.59 | 6 | 2 | 2 | N | 65245 |  |
 |
ubiquitinyl hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Usp39 PE=1 SV=1 |
| 1894 | 81316 | tr|A0A8I5Y176|A0A8I5Y176_RAT | 32.54 | 2 | 1 | 1 | N | 75692 |  |
 |
Ran-binding protein 9 OS=Rattus norvegicus OX=10116 GN=Ranbp9 PE=1 SV=1 |
| 2442 | 5610 | P63045|VAMP2_RAT | 32.54 | 14 | 1 | 1 | N | 12691 |  |
 |
Vesicle-associated membrane protein 2 OS=Rattus norvegicus OX=10116 GN=Vamp2 PE=1 SV=2 |
| 2442 | 26249 | tr|A0A8I6AQV6|A0A8I6AQV6_RAT | 32.54 | 12 | 1 | 1 | N | 14606 | |
|
Vesicle-associated membrane protein 2 OS=Rattus norvegicus OX=10116 GN=Vamp2 PE=1 SV=1 |
| 2442 | 26250 | tr|A0A8I5ZNB8|A0A8I5ZNB8_RAT | 32.54 | 12 | 1 | 1 | N | 14581 | |
|
Vesicle-associated membrane protein 2 OS=Rattus norvegicus OX=10116 GN=Vamp2 PE=3 SV=1 |
| 560 | 1426 | Q9JLJ3|AL9A1_RAT | 32.51 | 5 | 2 | 2 | Y | 53653 |  |
 |
4-trimethylaminobutyraldehyde dehydrogenase OS=Rattus norvegicus OX=10116 GN=Aldh9a1 PE=1 SV=1 |
| 560 | 23397 | tr|A0A8I6AQJ5|A0A8I6AQJ5_RAT | 32.51 | 5 | 2 | 2 | Y | 54050 | |
|
4-trimethylaminobutyraldehyde dehydrogenase OS=Rattus norvegicus OX=10116 GN=Aldh9a1 PE=1 SV=1 |
| 459 | 28245 | tr|A0A0G2K9L9|A0A0G2K9L9_RAT | 32.35 | 0 | 1 | 1 | N | 630068 |  |
 |
Midasin OS=Rattus norvegicus OX=10116 GN=Mdn1 PE=1 SV=2 |
| 444 | 23543 | tr|F1LPV0|F1LPV0_RAT | 32.00 | 4 | 2 | 2 | Y | 64128 |  |
 |
Asparagine--tRNA ligase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Nars1 PE=1 SV=2 |
| 444 | 23570 | tr|A0A0G2JUE7|A0A0G2JUE7_RAT | 32.00 | 4 | 2 | 2 | Y | 63194 | |
|
Asparagine--tRNA ligase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Nars1 PE=1 SV=1 |
| 2363 | 8118 | Q3T1I4|PRRC1_RAT | 31.79 | 3 | 1 | 1 | N | 46279 |  |
 |
Protein PRRC1 OS=Rattus norvegicus OX=10116 GN=Prrc1 PE=2 SV=2 |
| 590 | 24357 | tr|Q4KLI7|Q4KLI7_RAT | 31.70 | 22 | 8 | 8 | Y | 58842 |  |
|
Splicing factor 3a, subunit 3 OS=Rattus norvegicus OX=10116 GN=Sf3a3 PE=1 SV=1 |
| 1341 | 2719 | P56571|ES1_RAT | 31.27 | 6 | 1 | 1 | N | 28173 |  |
 |
ES1 protein homolog, mitochondrial OS=Rattus norvegicus OX=10116 PE=1 SV=2 |
| 605 | 3163 | Q6AXS3|DEK_RAT | 30.89 | 6 | 2 | 2 | Y | 42892 |  |
 |
Protein DEK OS=Rattus norvegicus OX=10116 GN=Dek PE=1 SV=1 |
| 605 | 24753 | tr|A0A8I6A9D8|A0A8I6A9D8_RAT | 30.89 | 6 | 2 | 2 | Y | 44266 | |
|
DEK proto-oncogene OS=Rattus norvegicus OX=10116 GN=Dek PE=1 SV=1 |
| 1248 | 3192 | O88767|PARK7_RAT | 30.43 | 4 | 1 | 1 | N | 19974 |  |
 |
Parkinson disease protein 7 homolog OS=Rattus norvegicus OX=10116 GN=Park7 PE=1 SV=1 |
| 2805 | 29376 | tr|D4ACM2|D4ACM2_RAT | 29.99 | 8 | 1 | 1 | N | 23539 |  |
 |
Mitotic arrest deficient 2 like 1 OS=Rattus norvegicus OX=10116 GN=Mad2l1 PE=3 SV=1 |
| 1733 | 25623 | tr|D3Z863|D3Z863_RAT | 29.67 | 2 | 1 | 1 | N | 60378 |  |
 |
CWF19-like protein 1 OS=Rattus norvegicus OX=10116 GN=Cwf19l1 PE=3 SV=1 |
| 274 | 961 | P49088|ASNS_RAT | 29.56 | 4 | 2 | 2 | N | 64247 |  |
 |
Asparagine synthetase [glutamine-hydrolyzing] OS=Rattus norvegicus OX=10116 GN=Asns PE=2 SV=3 |
| 2527 | 42564 | Q5PPH0|ENOPH_RAT | 29.52 | 13 | 2 | 2 | Y | 28875 |  |
 |
Enolase-phosphatase E1 OS=Rattus norvegicus OX=10116 GN=Enoph1 PE=2 SV=1 |
| 2527 | 42565 | tr|A0A8I6ADH3|A0A8I6ADH3_RAT | 29.52 | 12 | 2 | 2 | Y | 30553 | |
|
Enolase-phosphatase E1 OS=Rattus norvegicus OX=10116 GN=Enoph1 PE=1 SV=1 |
| 939 | 2349 | P86182|CCD22_RAT | 29.33 | 4 | 1 | 1 | Y | 70855 |  |
 |
Coiled-coil domain-containing protein 22 OS=Rattus norvegicus OX=10116 GN=Ccdc22 PE=1 SV=2 |
| 2689 | 61441 | tr|A0A8I6ARL0|A0A8I6ARL0_RAT | 29.24 | 3 | 1 | 1 | Y | 57842 |  |
 |
alanine transaminase OS=Rattus norvegicus OX=10116 GN=Gpt2 PE=3 SV=1 |
| 2689 | 61442 | tr|A0A8I6ACI1|A0A8I6ACI1_RAT | 29.24 | 3 | 1 | 1 | Y | 58887 | |
|
alanine transaminase OS=Rattus norvegicus OX=10116 GN=Gpt2 PE=1 SV=1 |
| 2689 | 61443 | tr|A0A0G2JV84|A0A0G2JV84_RAT | 29.24 | 3 | 1 | 1 | Y | 60289 | |
|
alanine transaminase OS=Rattus norvegicus OX=10116 GN=Gpt2 PE=1 SV=1 |
| 988 | 24586 | P36876|2ABA_RAT | 28.95 | 21 | 6 | 6 | Y | 51678 |  |
|
Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Rattus norvegicus OX=10116 GN=Ppp2r2a PE=2 SV=1 |
| 796 | 24300 | tr|A0A8I5ZUU8|A0A8I5ZUU8_RAT | 28.91 | 7 | 4 | 4 | Y | 106615 |  |
 |
5'-3' exoribonuclease OS=Rattus norvegicus OX=10116 GN=Xrn2 PE=1 SV=1 |
| 796 | 24301 | tr|D4A914|D4A914_RAT | 28.91 | 7 | 4 | 4 | Y | 108647 | |
|
5'-3' exoribonuclease OS=Rattus norvegicus OX=10116 GN=Xrn2 PE=1 SV=3 |
| 896 | 3634 | Q5U2N0|PYRG2_RAT | 28.65 | 2 | 1 | 1 | Y | 65674 |  |
 |
CTP synthase 2 OS=Rattus norvegicus OX=10116 GN=Ctps2 PE=1 SV=1 |
| 896 | 24946 | tr|A0A8L2QRH2|A0A8L2QRH2_RAT | 28.65 | 1 | 1 | 1 | Y | 68061 | |
|
CTP synthase OS=Rattus norvegicus OX=10116 GN=Ctps2 PE=1 SV=1 |
| 2082 | 25335 | Q5U316|RAB35_RAT | 28.61 | 9 | 1 | 1 | N | 23025 |  |
 |
Ras-related protein Rab-35 OS=Rattus norvegicus OX=10116 GN=Rab35 PE=1 SV=1 |
| 347 | 702 | P00507|AATM_RAT | 28.38 | 10 | 4 | 4 | Y | 47314 |  |
 |
Aspartate aminotransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Got2 PE=1 SV=2 |
| 347 | 23033 | tr|A0A8L2Q7Q0|A0A8L2Q7Q0_RAT | 28.38 | 10 | 4 | 4 | Y | 46915 | |
|
Aspartate aminotransferase OS=Rattus norvegicus OX=10116 GN=Got2 PE=1 SV=1 |
| 1973 | 5230 | P08082|CLCB_RAT | 28.31 | 4 | 1 | 1 | Y | 25117 |  |
 |
Clathrin light chain B OS=Rattus norvegicus OX=10116 GN=Cltb PE=1 SV=1 |
| 481 | 23487 | tr|A0A8I5ZLP6|A0A8I5ZLP6_RAT | 28.31 | 15 | 9 | 9 | Y | 107818 |  |
 |
RNA helicase OS=Rattus norvegicus OX=10116 GN=Ddx42 PE=1 SV=1 |
| 481 | 23486 | tr|D4A031|D4A031_RAT | 28.31 | 16 | 9 | 9 | Y | 102067 | |
|
RNA helicase OS=Rattus norvegicus OX=10116 GN=Ddx42 PE=1 SV=1 |
| 848 | 23765 | tr|D4A3E1|D4A3E1_RAT | 28.26 | 6 | 2 | 2 | N | 64363 |  |
 |
Heterogeneous nuclear ribonucleoprotein L-like OS=Rattus norvegicus OX=10116 GN=Hnrnpll PE=1 SV=1 |
| 292 | 22823 | tr|A0A0G2KBC7|A0A0G2KBC7_RAT | 28.26 | 11 | 6 | 6 | Y | 93524 |  |
|
ATP-dependent 6-phosphofructokinase OS=Rattus norvegicus OX=10116 GN=Pfkm PE=1 SV=1 |
| 292 | 22821 | tr|Q52KS1|Q52KS1_RAT | 28.26 | 12 | 6 | 6 | Y | 85343 | |
|
ATP-dependent 6-phosphofructokinase OS=Rattus norvegicus OX=10116 GN=Pfkm PE=1 SV=1 |
| 996 | 2376 | Q9WUC8|PLRG1_RAT | 27.92 | 4 | 1 | 1 | Y | 57189 |  |
 |
Pleiotropic regulator 1 OS=Rattus norvegicus OX=10116 GN=Plrg1 PE=2 SV=1 |
| 940 | 24062 | tr|A0A8I6AH11|A0A8I6AH11_RAT | 27.89 | 5 | 2 | 2 | Y | 49725 |  |
 |
Annexin OS=Rattus norvegicus OX=10116 GN=Anxa7 PE=1 SV=1 |
| 1476 | 42607 | tr|A0A0G2JXM5|A0A0G2JXM5_RAT | 27.73 | 3 | 1 | 1 | N | 44264 |  |
 |
DNA polymerase delta interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Poldip3 PE=1 SV=2 |
| 943 | 1729 | Q9JHL4|DBNL_RAT | 27.56 | 3 | 1 | 1 | Y | 48613 |  |
 |
Drebrin-like protein OS=Rattus norvegicus OX=10116 GN=Dbnl PE=1 SV=1 |
| 917 | 24038 | tr|A0A8I6A7T6|A0A8I6A7T6_RAT | 26.80 | 3 | 1 | 1 | N | 47180 |  |
 |
Rho GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Arhgap1 PE=1 SV=1 |
| 917 | 24039 | tr|D4A6C5|D4A6C5_RAT | 26.80 | 3 | 1 | 1 | N | 50623 | |
|
Rho GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Arhgap1 PE=1 SV=1 |
| 917 | 24040 | tr|A0A0G2JYR5|A0A0G2JYR5_RAT | 26.80 | 2 | 1 | 1 | N | 58488 | |
|
Rho GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Arhgap1 PE=1 SV=1 |
| 1735 | 26409 | tr|Q5U214|Q5U214_RAT | 26.72 | 13 | 2 | 2 | Y | 31176 |  |
 |
U1 small nuclear ribonucleoprotein A OS=Rattus norvegicus OX=10116 GN=Snrpa PE=3 SV=1 |
| 8 | 22610 | tr|A0A8J8XU90|A0A8J8XU90_RAT | 26.51 | 3 | 3 | 3 | Y | 226627 |  |
 |
Myosin-9 OS=Rattus norvegicus OX=10116 GN=Myh9 PE=1 SV=1 |
| 1470 | 26028 | tr|A0A8I6GLV2|A0A8I6GLV2_RAT | 26.45 | 5 | 1 | 1 | Y | 67761 |  |
 |
Cytosolic purine 5'-nucleotidase OS=Rattus norvegicus OX=10116 GN=Nt5c2 PE=1 SV=1 |
| 1470 | 26012 | tr|A0A8L2QH70|A0A8L2QH70_RAT | 26.45 | 5 | 1 | 1 | Y | 67822 | |
|
Cytosolic purine 5'-nucleotidase OS=Rattus norvegicus OX=10116 GN=Nt5c2 PE=1 SV=1 |
| 1470 | 5234 | D3ZMY7|5NTC_RAT | 26.45 | 5 | 1 | 1 | Y | 64866 | |
|
Cytosolic purine 5'-nucleotidase OS=Rattus norvegicus OX=10116 GN=Nt5c2 PE=1 SV=4 |
| 1470 | 26027 | tr|A0A8I6A978|A0A8I6A978_RAT | 26.45 | 5 | 1 | 1 | Y | 67650 | |
|
Cytosolic purine 5'-nucleotidase OS=Rattus norvegicus OX=10116 GN=Nt5c2 PE=1 SV=1 |
| 1236 | 25039 | tr|A0A8I6G251|A0A8I6G251_RAT | 25.96 | 2 | 1 | 1 | Y | 95053 |  |
 |
Transportin 3 OS=Rattus norvegicus OX=10116 GN=Tnpo3 PE=1 SV=1 |
| 88 | 23129 | tr|F1LQT9|F1LQT9_RAT | 25.77 | 4 | 5 | 5 | Y | 183038 |  |
 |
DNA (cytosine-5)-methyltransferase OS=Rattus norvegicus OX=10116 GN=Dnmt1 PE=1 SV=3 |
| 81 | 23055 | tr|A0A0U1RS25|A0A0U1RS25_RAT | 25.75 | 24 | 17 | 17 | Y | 123953 |  |
 |
UPF1, RNA helicase and ATPase OS=Rattus norvegicus OX=10116 GN=Upf1 PE=1 SV=1 |
| 1525 | 26366 | tr|A0A8I6AT53|A0A8I6AT53_RAT | 25.72 | 3 | 1 | 1 | Y | 43283 |  |
 |
Golgi reassembly stacking protein 2 OS=Rattus norvegicus OX=10116 GN=Gorasp2 PE=1 SV=1 |
| 1525 | 26367 | tr|F6T071|F6T071_RAT | 25.72 | 3 | 1 | 1 | Y | 45298 | |
|
Golgi reassembly stacking protein 2 OS=Rattus norvegicus OX=10116 GN=Gorasp2 PE=1 SV=3 |
| 1525 | 26368 | tr|A0A0G2K3Q2|A0A0G2K3Q2_RAT | 25.72 | 3 | 1 | 1 | Y | 46855 | |
|
Golgi reassembly stacking protein 2 OS=Rattus norvegicus OX=10116 GN=Gorasp2 PE=1 SV=1 |
| 1525 | 26369 | tr|Q68G33|Q68G33_RAT | 25.72 | 3 | 1 | 1 | Y | 47310 | |
|
Golgi reassembly stacking protein 2 OS=Rattus norvegicus OX=10116 GN=Gorasp2 PE=3 SV=1 |
| 1913 | 41941 | tr|A0A8I6AMP1|A0A8I6AMP1_RAT | 25.38 | 3 | 1 | 1 | N | 44141 |  |
 |
V-type proton ATPase subunit OS=Rattus norvegicus OX=10116 GN=Atp6v0d1 PE=1 SV=1 |
| 1913 | 41942 | tr|F7FFW7|F7FFW7_RAT | 25.38 | 3 | 1 | 1 | N | 46943 | |
|
ATPase H+ transporting V0 subunit D1 OS=Rattus norvegicus OX=10116 GN=Atp6v0d1 PE=1 SV=1 |
| 550 | 25812 | tr|A0A8I6G5P1|A0A8I6G5P1_RAT | 24.89 | 10 | 4 | 4 | Y | 46099 |  |
 |
Heterogeneous nuclear ribonucleoprotein D-like OS=Rattus norvegicus OX=10116 GN=Hnrnpdl PE=1 SV=1 |
| 550 | 25813 | tr|A0A0G2KAZ7|A0A0G2KAZ7_RAT | 24.89 | 10 | 4 | 4 | Y | 46307 | |
|
Heterogeneous nuclear ribonucleoprotein D-like OS=Rattus norvegicus OX=10116 GN=Hnrnpdl PE=1 SV=1 |
| 447 | 23096 | tr|A6IA08|A6IA08_RAT | 24.79 | 2 | 1 | 1 | N | 61491 |  |
 |
BAG cochaperone 3 OS=Rattus norvegicus OX=10116 GN=Bag3 PE=1 SV=1 |
| 608 | 27865 | Q6AYB5|SRP54_RAT | 24.60 | 10 | 4 | 4 | N | 55705 |  |
 |
Signal recognition particle subunit SRP54 OS=Rattus norvegicus OX=10116 GN=Srp54 PE=2 SV=1 |
| 1003 | 24260 | P04897|GNAI2_RAT | 24.26 | 11 | 3 | 3 | Y | 40499 |  |
 |
Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Gnai2 PE=1 SV=3 |
| 1087 | 23700 | tr|M0R9B9|M0R9B9_RAT | 24.17 | 4 | 1 | 1 | N | 54837 |  |
 |
UBX domain protein 7 OS=Rattus norvegicus OX=10116 GN=AABR07034438.1 PE=4 SV=2 |
| 516 | 26296 | tr|G3V752|G3V752_RAT | 23.92 | 4 | 3 | 3 | Y | 115334 |  |
 |
RNA cytidine acetyltransferase OS=Rattus norvegicus OX=10116 GN=Nat10 PE=1 SV=1 |
| 516 | 26295 | tr|A0A0G2JV51|A0A0G2JV51_RAT | 23.92 | 4 | 3 | 3 | Y | 111745 | |
|
RNA cytidine acetyltransferase OS=Rattus norvegicus OX=10116 GN=Nat10 PE=1 SV=2 |
| 657 | 24019 | tr|A0A0G2KAN7|A0A0G2KAN7_RAT | 23.29 | 3 | 1 | 1 | N | 65838 |  |
 |
glutaminase OS=Rattus norvegicus OX=10116 GN=Gls PE=1 SV=1 |
| 995 | 61286 | tr|G3V727|G3V727_RAT | 23.07 | 3 | 1 | 1 | N | 50989 |  |
 |
RNA helicase OS=Rattus norvegicus OX=10116 GN=Ddx47 PE=1 SV=2 |
| 995 | 61285 | tr|A0A8I5ZKX7|A0A8I5ZKX7_RAT | 23.07 | 3 | 1 | 1 | N | 50610 | |
|
RNA helicase OS=Rattus norvegicus OX=10116 GN=Ddx47 PE=1 SV=1 |
| 995 | 61284 | tr|A0A8I6A8V5|A0A8I6A8V5_RAT | 23.07 | 3 | 1 | 1 | N | 48989 | |
|
RNA helicase OS=Rattus norvegicus OX=10116 GN=Ddx47 PE=1 SV=1 |
| 1371 | 7163 | Q6P7Q4|LGUL_RAT | 23.02 | 5 | 1 | 1 | N | 20820 |  |
 |
Lactoylglutathione lyase OS=Rattus norvegicus OX=10116 GN=Glo1 PE=1 SV=3 |
| 555 | 1792 | P17425|HMCS1_RAT | 22.82 | 5 | 2 | 2 | N | 57434 |  |
 |
Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Hmgcs1 PE=1 SV=1 |
| 555 | 23743 | tr|A0A8I6AH54|A0A8I6AH54_RAT | 22.82 | 5 | 2 | 2 | N | 57049 | |
|
Hydroxymethylglutaryl-CoA synthase OS=Rattus norvegicus OX=10116 GN=Hmgcs1 PE=1 SV=1 |
| 1049 | 5949 | Q3B7D0|HEM6_RAT | 22.76 | 5 | 2 | 2 | N | 49278 |  |
 |
Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cpox PE=1 SV=1 |
| 2072 | 27708 | tr|A0A8I6A412|A0A8I6A412_RAT | 22.74 | 2 | 1 | 1 | Y | 70688 |  |
 |
WD repeat domain 46 OS=Rattus norvegicus OX=10116 GN=Wdr46 PE=1 SV=1 |
| 1184 | 24482 | tr|A0A8I6AF13|A0A8I6AF13_RAT | 22.60 | 4 | 2 | 2 | N | 65388 |  |
 |
Aldehyde dehydrogenase family 3 member A2 OS=Rattus norvegicus OX=10116 GN=Aldh3a2 PE=1 SV=1 |
| 1184 | 24481 | tr|G3V9W6|G3V9W6_RAT | 22.60 | 4 | 2 | 2 | N | 62653 | |
|
Aldehyde dehydrogenase family 3 member A2 OS=Rattus norvegicus OX=10116 GN=Aldh3a2 PE=3 SV=2 |
| 1184 | 24501 | tr|A0A8I6AE89|A0A8I6AE89_RAT | 22.60 | 5 | 2 | 2 | N | 57728 | |
|
Aldehyde dehydrogenase OS=Rattus norvegicus OX=10116 GN=Aldh3a2 PE=1 SV=1 |
| 1184 | 24498 | tr|A0A0G2JY43|A0A0G2JY43_RAT | 22.60 | 5 | 2 | 2 | N | 53938 | |
|
Aldehyde dehydrogenase OS=Rattus norvegicus OX=10116 GN=Aldh3a2 PE=1 SV=2 |
| 1184 | 24499 | tr|A0A8I6GJ33|A0A8I6GJ33_RAT | 22.60 | 5 | 2 | 2 | N | 54509 | |
|
Aldehyde dehydrogenase OS=Rattus norvegicus OX=10116 GN=Aldh3a2 PE=1 SV=1 |
| 239 | 1404 | Q9Z2Q1|SC31A_RAT | 22.53 | 4 | 4 | 4 | Y | 135272 |  |
 |
Protein transport protein Sec31A OS=Rattus norvegicus OX=10116 GN=Sec31a PE=1 SV=2 |
| 239 | 23301 | tr|G3V699|G3V699_RAT | 22.53 | 4 | 4 | 4 | Y | 135198 | |
|
Protein transport protein Sec31A OS=Rattus norvegicus OX=10116 GN=Sec31a PE=1 SV=1 |
| 239 | 23297 | tr|A0A8L2QIX3|A0A8L2QIX3_RAT | 22.53 | 4 | 4 | 4 | Y | 120916 | |
|
Protein transport protein Sec31A OS=Rattus norvegicus OX=10116 GN=Sec31a PE=1 SV=1 |
| 239 | 23302 | tr|A0A0G2K0X9|A0A0G2K0X9_RAT | 22.53 | 4 | 4 | 4 | Y | 133434 | |
|
Protein transport protein Sec31A OS=Rattus norvegicus OX=10116 GN=Sec31a PE=1 SV=2 |
| 3377 | 31045 | tr|A0A8I6GJD3|A0A8I6GJD3_RAT | 22.09 | 2 | 1 | 1 | N | 93429 |  |
 |
Mitogen-activated protein kinase kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map4k5 PE=1 SV=1 |
| 3377 | 61438 | tr|D3ZHL6|D3ZHL6_RAT | 22.09 | 2 | 1 | 1 | N | 95125 | |
|
Mitogen-activated protein kinase kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map4k5 PE=1 SV=3 |
| 3377 | 61439 | tr|A0A8I6AJ75|A0A8I6AJ75_RAT | 22.09 | 2 | 1 | 1 | N | 95983 | |
|
Mitogen-activated protein kinase kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map4k5 PE=1 SV=1 |
| 2776 | 61411 | tr|B2RZ20|B2RZ20_RAT | 21.56 | 11 | 1 | 1 | N | 13557 |  |
 |
SS nuclear autoantigen 1 OS=Rattus norvegicus OX=10116 GN=Ssna1 PE=4 SV=1 |
| 2459 | 29279 | tr|A0A8L2Q4S5|A0A8L2Q4S5_RAT | 21.27 | 4 | 1 | 1 | N | 35147 |  |
 |
3-hydroxyisobutyrate dehydrogenase OS=Rattus norvegicus OX=10116 GN=Hibadh PE=1 SV=1 |
| 2459 | 29280 | P29266|3HIDH_RAT | 21.27 | 4 | 1 | 1 | N | 35303 | |
|
3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hibadh PE=1 SV=3 |
| 932 | 26038 | tr|A0A0G2JSG6|A0A0G2JSG6_RAT | 21.18 | 9 | 2 | 2 | N | 25529 |  |
 |
Adenylate kinase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ak2 PE=3 SV=1 |
| 2655 | 6622 | P62076|TIM13_RAT | 21.15 | 31 | 2 | 2 | Y | 10458 |  |
 |
Mitochondrial import inner membrane translocase subunit Tim13 OS=Rattus norvegicus OX=10116 GN=Timm13 PE=3 SV=1 |
| 1127 | 25553 | tr|B2RZ74|B2RZ74_RAT | 20.59 | 9 | 3 | 3 | N | 52133 |  |
 |
U1 small nuclear ribonucleoprotein 70 kDa OS=Rattus norvegicus OX=10116 GN=Snrnp70 PE=1 SV=1 |
| 433 | 605 | P41562|IDHC_RAT | 20.47 | 15 | 6 | 6 | Y | 46734 |  |
 |
Isocitrate dehydrogenase [NADP] cytoplasmic OS=Rattus norvegicus OX=10116 GN=Idh1 PE=1 SV=1 |
| 58 | 22918 | tr|G3V8T4|G3V8T4_RAT | 20.46 | 3 | 4 | 4 | Y | 126941 |  |
 |
DNA damage-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ddb1 PE=1 SV=1 |
| 3172 | 11694 | P61078|UB2D3_RAT | 20.10 | 7 | 1 | 1 | N | 16687 |  |
 |
Ubiquitin-conjugating enzyme E2 D3 OS=Rattus norvegicus OX=10116 GN=Ube2d3 PE=2 SV=1 |
| 3172 | 30954 | tr|A0A0G2K739|A0A0G2K739_RAT | 20.10 | 7 | 1 | 1 | N | 16693 | |
|
Ubiquitin-conjugating enzyme E2 D3 OS=Rattus norvegicus OX=10116 GN=Ube2d3 PE=3 SV=2 |
| 3172 | 30955 | tr|A0A8I5ZTF1|A0A8I5ZTF1_RAT | 20.10 | 7 | 1 | 1 | N | 16785 | |
|
Ubiquitin-conjugating enzyme E2 D3 OS=Rattus norvegicus OX=10116 GN=Ube2d3 PE=3 SV=1 |
| total 728 proteins |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LSDGVAVLK.V | Y | Y | 5.74 | 8.49 | 1.0 | 8.3766E7 |  |
 |
2.5495E7 | 1.0842E8 | 1.1738E8 | 4.60 | 1 | 397 | 405 | |
| K.VGGTSDVEVNEK.K | Y | Y | 4.73 | 5.28 | 0.8 | 7.2153E7 |  |
 |
2.6145E7 | 9.9054E7 | 1.1602E8 | 4.44 | 1 | 406 | 417 | |
| R.VTDALNATR.A | Y | Y | 4.50 | 4.25 | 2.5 | 7.0857E7 |  |
 |
2.7692E7 | 7.0087E7 | 1.1479E8 | 4.15 | 1 | 421 | 429 | |
| K.GANPVEIR.R | N | Y | 5.21 | 5.25 | 0.6 | 5.3362E7 |  |
 |
2.1224E7 | 7.155E7 | 8.5198E7 | 4.01 | 1 | 134 | 141 | |
| K.TLNDELEIIEGMK.F | N | Y | 4.70 | 2.68 | 1.8 | 4.9827E7 |  |
 |
2.6498E7 | 6.8249E7 | 5.4733E7 | 2.58 | 1 | 206 | 218 | |
| K.TLNDELEIIEGM(+15.99)K.F | N | Y | 3.76 | 3.78 | 1.5 | 1.0746E7 |  |
 |
3.4125E6 | 1.1244E7 | 1.758E7 | 5.15 | 1 | 206 | 218 | Oxidation (M) |
| R.RGVMLAVDAVIAELKK.Q | N | Y | 4.74 | 0.04 | 3.0 | 1.2218E6 |  |
 |
1.2108E6 | 1.232E6 | 1.2227E6 | 1.02 | 1 | 142 | 157 | |
| R.GVM(+15.99)LAVDAVIAELKK.Q | N | Y | 3.91 | 1.04 | 0.7 | 4.9308E5 |  |
 |
4.2613E5 | 4.8127E5 | 6.7837E5 | 1.59 | 1 | 143 | 157 | Oxidation (M) |
| R.RGVMLAVDAVIAELK.K | N | Y | 5.32 | 6.02 | 0.9 | 2.1775E5 |  |
 |
9.8504E4 | 3.5972E5 | 1.9502E5 | 3.65 | 1 | 142 | 156 | |
| total 9 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VLAGETLSVNDPPDVLDR.Q | Y | Y | 5.39 | 7.58 | 0.8 | 1.6882E7 |  |
 |
5.4622E6 | 2.3172E7 | 2.201E7 | 4.24 | 1 | 183 | 200 | |
| K.AYAALAALEK.L | N | Y | 5.06 | 7.25 | 0.4 | 1.3304E7 |  |
 |
3.3752E6 | 1.7171E7 | 1.9367E7 | 5.74 | 1 | 578 | 587 | |
| K.AVSDWIDEQEK.G | N | Y | 5.41 | 2.73 | 5.9 | 1.1218E7 |  |
 |
5.4813E6 | 1.4514E7 | 1.3658E7 | 2.65 | 1 | 44 | 54 | |
| K.VLQDMGLPTGAEGR.D | N | Y | 5.31 | 11.67 | 0.6 | 1.0472E7 |  |
 |
1.5221E6 | 1.441E7 | 1.5485E7 | 10.17 | 1 | 461 | 474 | |
| R.EDITQSAQHALR.L | Y | Y | 7.85 | 10.24 | 0.8 | 1.3808E7 |  |
 |
2.7488E6 | 2.156E7 | 2.2507E7 | 8.19 | 2 | 312 | 323 | |
| R.LNQLKPGLQYK.L | N | Y | 5.37 | 15.92 | 0.8 | 1.3595E7 |  |
 |
3.1004E6 | 2.1721E7 | 2.1393E7 | 7.01 | 2 | 409 | 419 | |
| R.GWPLELLC(+57.02)EK.S | N | Y | 4.43 | 4.83 | 0.5 | 8.742E6 |  |
 |
2.4281E6 | 1.3214E7 | 1.0584E7 | 5.44 | 1 | 248 | 257 | Carbamidomethylation |
| R.VPTWGPLR.G | N | Y | 7.21 | 8.30 | 2.3 | 8.2186E6 |  |
 |
1.615E6 | 1.1555E7 | 1.1486E7 | 7.15 | 1 | 240 | 247 | |
| K.HSSVYPTQEELEAVQNMVSHTER.A | Y | Y | 6.64 | 5.67 | 0.9 | 1.3656E7 |  |
 |
4.5648E6 | 1.8825E7 | 1.7579E7 | 4.12 | 2 | 18 | 40 | |
| R.VLEC(+57.02)LASGIVMPDGSGIYDPC(+57.02)EK.E | N | Y | 3.05 | 2.37 | 3.7 | 4.2799E6 |  |
 |
1.2425E6 | 5.4165E6 | 6.1807E6 | 4.97 | 1 | 275 | 297 | Carbamidomethylation |
| K.AEPPQAMNALMR.L | N | Y | 5.23 | 5.17 | 5.2 | 2.8098E6 |  |
 |
1.1797E6 | 2.8607E6 | 4.389E6 | 3.72 | 1 | 397 | 408 | |
| total 11 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VLAGETLSVNDPPDVLDR.Q | Y | Y | 5.39 | 7.58 | 0.8 | 1.6882E7 | |
|
5.4622E6 | 2.3172E7 | 2.201E7 | 4.24 | 1 | 188 | 205 | |
| K.AYAALAALEK.L | N | Y | 5.06 | 7.25 | 0.4 | 1.3304E7 | |
|
3.3752E6 | 1.7171E7 | 1.9367E7 | 5.74 | 1 | 583 | 592 | |
| K.AVSDWIDEQEK.G | N | Y | 5.41 | 2.73 | 5.9 | 1.1218E7 | |
|
5.4813E6 | 1.4514E7 | 1.3658E7 | 2.65 | 1 | 49 | 59 | |
| K.VLQDMGLPTGAEGR.D | N | Y | 5.31 | 11.67 | 0.6 | 1.0472E7 | |
|
1.5221E6 | 1.441E7 | 1.5485E7 | 10.17 | 1 | 466 | 479 | |
| R.EDITQSAQHALR.L | Y | Y | 7.85 | 10.24 | 0.8 | 1.3808E7 | |
|
2.7488E6 | 2.156E7 | 2.2507E7 | 8.19 | 2 | 317 | 328 | |
| R.LNQLKPGLQYK.L | N | Y | 5.37 | 15.92 | 0.8 | 1.3595E7 | |
|
3.1004E6 | 2.1721E7 | 2.1393E7 | 7.01 | 2 | 414 | 424 | |
| R.GWPLELLC(+57.02)EK.S | N | Y | 4.43 | 4.83 | 0.5 | 8.742E6 | |
|
2.4281E6 | 1.3214E7 | 1.0584E7 | 5.44 | 1 | 253 | 262 | Carbamidomethylation |
| R.VPTWGPLR.G | N | Y | 7.21 | 8.30 | 2.3 | 8.2186E6 | |
|
1.615E6 | 1.1555E7 | 1.1486E7 | 7.15 | 1 | 245 | 252 | |
| K.HSSVYPTQEELEAVQNMVSHTER.A | Y | Y | 6.64 | 5.67 | 0.9 | 1.3656E7 | |
|
4.5648E6 | 1.8825E7 | 1.7579E7 | 4.12 | 2 | 23 | 45 | |
| R.VLEC(+57.02)LASGIVMPDGSGIYDPC(+57.02)EK.E | N | Y | 3.05 | 2.37 | 3.7 | 4.2799E6 | |
|
1.2425E6 | 5.4165E6 | 6.1807E6 | 4.97 | 1 | 280 | 302 | Carbamidomethylation |
| K.AEPPQAMNALMR.L | N | Y | 5.23 | 5.17 | 5.2 | 2.8098E6 | |
|
1.1797E6 | 2.8607E6 | 4.389E6 | 3.72 | 1 | 402 | 413 | |
| total 11 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VLAGETLSVNDPPDVLDR.Q | Y | Y | 5.39 | 7.58 | 0.8 | 1.6882E7 | |
|
5.4622E6 | 2.3172E7 | 2.201E7 | 4.24 | 1 | 183 | 200 | |
| K.AYAALAALEK.L | N | Y | 5.06 | 7.25 | 0.4 | 1.3304E7 | |
|
3.3752E6 | 1.7171E7 | 1.9367E7 | 5.74 | 1 | 578 | 587 | |
| K.AVSDWIDEQEK.G | N | Y | 5.41 | 2.73 | 5.9 | 1.1218E7 | |
|
5.4813E6 | 1.4514E7 | 1.3658E7 | 2.65 | 1 | 44 | 54 | |
| K.VLQDMGLPTGAEGR.D | N | Y | 5.31 | 11.67 | 0.6 | 1.0472E7 | |
|
1.5221E6 | 1.441E7 | 1.5485E7 | 10.17 | 1 | 461 | 474 | |
| R.EDITQSAQHALR.L | Y | Y | 7.85 | 10.24 | 0.8 | 1.3808E7 | |
|
2.7488E6 | 2.156E7 | 2.2507E7 | 8.19 | 2 | 312 | 323 | |
| R.LNQLKPGLQYK.L | N | Y | 5.37 | 15.92 | 0.8 | 1.3595E7 | |
|
3.1004E6 | 2.1721E7 | 2.1393E7 | 7.01 | 2 | 409 | 419 | |
| R.GWPLELLC(+57.02)EK.S | N | Y | 4.43 | 4.83 | 0.5 | 8.742E6 | |
|
2.4281E6 | 1.3214E7 | 1.0584E7 | 5.44 | 1 | 248 | 257 | Carbamidomethylation |
| R.VPTWGPLR.G | N | Y | 7.21 | 8.30 | 2.3 | 8.2186E6 | |
|
1.615E6 | 1.1555E7 | 1.1486E7 | 7.15 | 1 | 240 | 247 | |
| K.HSSVYPTQEELEAVQNMVSHTER.A | Y | Y | 6.64 | 5.67 | 0.9 | 1.3656E7 | |
|
4.5648E6 | 1.8825E7 | 1.7579E7 | 4.12 | 2 | 18 | 40 | |
| R.VLEC(+57.02)LASGIVMPDGSGIYDPC(+57.02)EK.E | N | Y | 3.05 | 2.37 | 3.7 | 4.2799E6 | |
|
1.2425E6 | 5.4165E6 | 6.1807E6 | 4.97 | 1 | 275 | 297 | Carbamidomethylation |
| K.AEPPQAMNALMR.L | N | Y | 5.23 | 5.17 | 5.2 | 2.8098E6 | |
|
1.1797E6 | 2.8607E6 | 4.389E6 | 3.72 | 1 | 397 | 408 | |
| total 11 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LAPITSDPTEAAAVGAVEASFK.C | Y | Y | 4.40 | 22.39 | 2.7 | 4.4707E7 |  |
 |
1.3197E8 | 1.7824E6 | 3.7091E5 | 64.00 | 1 | 401 | 422 | |
| R.EAEAAIYHLQLFEELR.R | Y | Y | 5.10 | 1.40 | 2.8 | 5.3238E6 |  |
 |
7.2986E6 | 4.6928E6 | 4.7273E6 | 1.56 | 2 | 384 | 399 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.TLGDFAAEYAK.S | Y | Y | 4.33 | 7.79 | 0.7 | 2.2443E7 |  |
 |
2.558E6 | 2.8187E7 | 3.6583E7 | 14.30 | 1 | 109 | 119 | |
| R.TTNFAGILSQGLR.I | Y | Y | 6.64 | 11.96 | 0.5 | 2.061E7 |  |
 |
3.0806E6 | 2.5137E7 | 3.3612E7 | 10.91 | 1 | 866 | 878 | |
| K.GGAAVDPDSGLEHSAHVLEK.G | Y | Y | 7.70 | 9.30 | 1.7 | 2.5975E7 |  |
 |
4.1137E6 | 3.2503E7 | 4.1309E7 | 10.04 | 2 | 529 | 548 | |
| K.KFYPLEIDYGQDEEAVKK.L | N | Y | 5.41 | 13.28 | 3.0 | 1.2642E7 |  |
 |
1.3373E6 | 1.5359E7 | 2.123E7 | 15.87 | 1 | 637 | 654 | |
| K.SDAYYC(+57.02)TGDVTAWTK.C | N | Y | 5.76 | 24.25 | 0.6 | 9.1304E6 |  |
 |
9.6916E5 | 1.1738E7 | 1.4684E7 | 15.15 | 1 | 307 | 321 | Carbamidomethylation |
| R.GGSDDSSKDPIDVNYEK.L | N | Y | 5.91 | 15.46 | 1.0 | 9.9282E6 |  |
 |
1.1736E6 | 1.5846E7 | 1.677E7 | 14.29 | 2 | 780 | 796 | |
| K.GIYFADMVSK.S | N | Y | 4.32 | 6.38 | 3.4 | 7.9958E6 |  |
 |
9.323E5 | 1.0045E7 | 1.301E7 | 13.95 | 1 | 894 | 903 | |
| K.VFSATLGLVDIVK.G | N | Y | 4.48 | 9.22 | 0.6 | 6.2484E6 |  |
 |
8.1518E5 | 9.552E6 | 8.3781E6 | 11.72 | 1 | 552 | 564 | |
| R.FYTLIPHDFGMK.K | N | Y | 4.08 | 15.76 | 0.6 | 5.2048E6 |  |
 |
2.3445E5 | 6.2179E6 | 9.2206E6 | 39.33 | 1 | 736 | 747 | |
| total 9 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IGVPSATEIIK.A | Y | Y | 5.04 | 4.77 | 0.5 | 1.3531E7 |  |
 |
5.0467E6 | 1.8145E7 | 1.74E7 | 3.60 | 1 | 559 | 569 | |
| R.APQVLVLAPTR.E | Y | Y | 5.69 | 6.61 | 0.6 | 1.3296E7 |  |
 |
4.2556E6 | 1.7819E7 | 1.7815E7 | 4.19 | 1 | 256 | 266 | |
| R.AAVIGDVIR.V | Y | Y | 5.37 | 10.74 | 1.2 | 1.1322E7 |  |
 |
3.2761E6 | 1.4573E7 | 1.6117E7 | 4.92 | 1 | 420 | 428 | |
| K.QDAQSLHGDIPQK.Q | N | Y | 4.18 | 3.71 | 1.4 | 7.5527E6 |  |
 |
3.0033E6 | 1.1223E7 | 1.1238E7 | 3.74 | 2 | 458 | 470 | |
| K.STYEQVDLIGK.K | N | Y | 26.58 | 10.14 | 0.6 | 5.2064E6 |  |
 |
1.4214E6 | 7.3307E6 | 6.8672E6 | 5.16 | 1 | 388 | 398 | |
| K.KDSEDNPQTLLFSATC(+57.02)PHWVFNVAK.K | N | Y | 5.87 | 4.62 | 1.1 | 6.9575E5 |  |
 |
2.8475E5 | 9.4328E5 | 9.3042E5 | 3.31 | 1 | 359 | 383 | Carbamidomethylation |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AIEPPPLDAVIEAEHTLR.E | Y | Y | 5.75 | 5.16 | 3.3 | 2.6795E7 |  |
 |
1.3207E7 | 2.9363E7 | 3.7814E7 | 2.86 | 1 | 823 | 840 | |
| R.AAEC(+57.02)NIVVTQPR.R | Y | Y | 6.24 | 9.72 | 0.5 | 1.7094E7 |  |
 |
5.6824E6 | 2.3956E7 | 2.7633E7 | 4.86 | 1 | 438 | 449 | Carbamidomethylation |
| R.YQILPLHSQIPR.E | N | Y | 7.35 | 4.13 | 0.5 | 1.6321E7 |  |
 |
5.7286E6 | 1.8362E7 | 2.4951E7 | 4.36 | 2 | 684 | 695 | |
| R.ELDALDANDELTPLGR.I | N | Y | 5.45 | 7.57 | 0.8 | 1.4608E7 |  |
 |
4.109E6 | 1.8235E7 | 2.1479E7 | 5.23 | 1 | 841 | 856 | |
| R.LGGIGQFLAK.A | N | Y | 4.79 | 7.64 | 0.5 | 1.1965E7 |  |
 |
3.4838E6 | 1.4525E7 | 1.7888E7 | 5.13 | 1 | 813 | 822 | |
| R.TPLHEIALSIK.L | N | Y | 5.60 | 9.11 | 0.7 | 1.6772E7 |  |
 |
6.9758E6 | 1.9232E7 | 2.5335E7 | 3.63 | 2 | 799 | 809 | |
| K.LAAQSC(+57.02)ALSLVR.Q | N | Y | 4.21 | 4.37 | 1.4 | 1.0163E7 |  |
 |
3.0147E6 | 1.225E7 | 1.5224E7 | 5.05 | 1 | 240 | 251 | Carbamidomethylation |
| R.KEEQEVQATLESEEVDLNAGLHGNWTLENAK.A | N | Y | 7.01 | 4.40 | 1.9 | 1.075E7 |  |
 |
4.3362E6 | 1.3226E7 | 1.4816E7 | 3.42 | 2 | 155 | 185 | |
| K.YPSPFFVFGEK.I | N | Y | 5.12 | 4.94 | 0.5 | 7.2126E6 |  |
 |
2.7656E6 | 8.6232E6 | 1.0249E7 | 3.71 | 1 | 1041 | 1051 | |
| K.SSVNC(+57.02)PFSSQDMK.Y | N | Y | 5.25 | 4.88 | 0.7 | 6.2002E6 |  |
 |
2.0973E6 | 8.828E6 | 9.8823E6 | 4.71 | 1 | 1028 | 1040 | Carbamidomethylation |
| R.LETHMTPEMFR.T | N | Y | 5.44 | 10.32 | 0.6 | 5.7959E6 |  |
 |
1.118E6 | 7.109E6 | 9.1609E6 | 8.19 | 1 | 788 | 798 | |
| R.GISHVIVDEIHER.D | Y | Y | 6.02 | 5.28 | 1.0 | 1.7043E7 |  |
 |
6.603E6 | 2.6945E7 | 1.9954E7 | 4.08 | 3 | 507 | 519 | |
| total 12 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AIEPPPLDAVIEAEHTLR.E | Y | Y | 5.75 | 5.16 | 3.3 | 2.6795E7 | |
|
1.3207E7 | 2.9363E7 | 3.7814E7 | 2.86 | 1 | 823 | 840 | |
| R.AAEC(+57.02)NIVVTQPR.R | Y | Y | 6.24 | 9.72 | 0.5 | 1.7094E7 | |
|
5.6824E6 | 2.3956E7 | 2.7633E7 | 4.86 | 1 | 438 | 449 | Carbamidomethylation |
| R.YQILPLHSQIPR.E | N | Y | 7.35 | 4.13 | 0.5 | 1.6321E7 | |
|
5.7286E6 | 1.8362E7 | 2.4951E7 | 4.36 | 2 | 684 | 695 | |
| R.ELDALDANDELTPLGR.I | N | Y | 5.45 | 7.57 | 0.8 | 1.4608E7 | |
|
4.109E6 | 1.8235E7 | 2.1479E7 | 5.23 | 1 | 841 | 856 | |
| R.LGGIGQFLAK.A | N | Y | 4.79 | 7.64 | 0.5 | 1.1965E7 | |
|
3.4838E6 | 1.4525E7 | 1.7888E7 | 5.13 | 1 | 813 | 822 | |
| R.TPLHEIALSIK.L | N | Y | 5.60 | 9.11 | 0.7 | 1.6772E7 | |
|
6.9758E6 | 1.9232E7 | 2.5335E7 | 3.63 | 2 | 799 | 809 | |
| K.LAAQSC(+57.02)ALSLVR.Q | N | Y | 4.21 | 4.37 | 1.4 | 1.0163E7 | |
|
3.0147E6 | 1.225E7 | 1.5224E7 | 5.05 | 1 | 240 | 251 | Carbamidomethylation |
| R.KEEQEVQATLESEEVDLNAGLHGNWTLENAK.A | N | Y | 7.01 | 4.40 | 1.9 | 1.075E7 | |
|
4.3362E6 | 1.3226E7 | 1.4816E7 | 3.42 | 2 | 155 | 185 | |
| K.YPSPFFVFGEK.I | N | Y | 5.12 | 4.94 | 0.5 | 7.2126E6 | |
|
2.7656E6 | 8.6232E6 | 1.0249E7 | 3.71 | 1 | 1041 | 1051 | |
| K.SSVNC(+57.02)PFSSQDMK.Y | N | Y | 5.25 | 4.88 | 0.7 | 6.2002E6 | |
|
2.0973E6 | 8.828E6 | 9.8823E6 | 4.71 | 1 | 1028 | 1040 | Carbamidomethylation |
| R.LETHMTPEMFR.T | N | Y | 5.44 | 10.32 | 0.6 | 5.7959E6 | |
|
1.118E6 | 7.109E6 | 9.1609E6 | 8.19 | 1 | 788 | 798 | |
| R.GISHVIVDEIHER.D | Y | Y | 6.02 | 5.28 | 1.0 | 1.7043E7 | |
|
6.603E6 | 2.6945E7 | 1.9954E7 | 4.08 | 3 | 507 | 519 | |
| total 12 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NQVALNPQNTVFDAK.R | Y | Y | 6.86 | 21.83 | 0.6 | 1.0308E8 |  |
 |
3.3637E6 | 1.5856E8 | 1.4732E8 | 47.14 | 1 | 57 | 71 | |
| R.IINEPTAAAIAYGLDR.T | Y | Y | 4.61 | 34.50 | 3.3 | 8.8638E7 |  |
 |
6.7555E5 | 1.2991E8 | 1.3533E8 | 64.00 | 1 | 172 | 187 | |
| R.FEELC(+57.02)SDLFR.G | Y | Y | 5.02 | 31.19 | 0.4 | 6.719E7 |  |
 |
1.4508E6 | 1.0846E8 | 9.1661E7 | 64.00 | 1 | 302 | 311 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NQVALNPQNTVFDAK.R | Y | Y | 6.86 | 21.83 | 0.6 | 1.0308E8 | |
|
3.3637E6 | 1.5856E8 | 1.4732E8 | 47.14 | 1 | 57 | 71 | |
| R.IINEPTAAAIAYGLDR.T | Y | Y | 4.61 | 34.50 | 3.3 | 8.8638E7 | |
|
6.7555E5 | 1.2991E8 | 1.3533E8 | 64.00 | 1 | 172 | 187 | |
| R.FEELC(+57.02)SDLFR.G | Y | Y | 5.02 | 31.19 | 0.4 | 6.719E7 | |
|
1.4508E6 | 1.0846E8 | 9.1661E7 | 64.00 | 1 | 302 | 311 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NQVALNPQNTVFDAK.R | Y | Y | 6.86 | 21.83 | 0.6 | 1.0308E8 | |
|
3.3637E6 | 1.5856E8 | 1.4732E8 | 47.14 | 1 | 57 | 71 | |
| R.IINEPTAAAIAYGLDR.T | Y | Y | 4.61 | 34.50 | 3.3 | 8.8638E7 | |
|
6.7555E5 | 1.2991E8 | 1.3533E8 | 64.00 | 1 | 172 | 187 | |
| R.FEELC(+57.02)SDLFR.G | Y | Y | 5.02 | 31.19 | 0.4 | 6.719E7 | |
|
1.4508E6 | 1.0846E8 | 9.1661E7 | 64.00 | 1 | 302 | 311 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IVLEDGTLHVTEGSGR.Y | Y | Y | 5.40 | 25.20 | 0.9 | 2.4662E7 |  |
 |
6.8117E7 | 2.9493E6 | 2.9179E6 | 23.34 | 2 | 553 | 568 | |
| R.GLYDGPVC(+57.02)EVSVTPK.T | Y | Y | 6.14 | 20.23 | 0.7 | 1.5666E7 |  |
 |
4.2701E7 | 2.2497E6 | 2.0483E6 | 20.85 | 1 | 598 | 612 | Carbamidomethylation |
| R.NLHQSGFSLSGAQIDDNIPR.R | Y | Y | 6.06 | 17.50 | 1.9 | 1.0369E7 |  |
 |
2.6418E7 | 2.4111E6 | 2.2778E6 | 11.60 | 1 | 634 | 653 | |
| R.DIGAIAQVHAENGDIIAEEQQR.I | N | Y | 5.20 | 19.71 | 1.0 | 4.3419E6 |  |
 |
1.1976E7 | 7.4843E5 | 4.0247E5 | 29.76 | 1 | 291 | 312 | |
| R.FQMPDQGMTSADDFFQGTK.A | N | Y | 5.48 | 24.90 | 1.0 | 2.934E6 |  |
 |
8.1342E6 | 3.3372E5 | 3.342E5 | 24.37 | 1 | 177 | 195 | |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ILLAELEQLK.G | Y | Y | 4.83 | 26.26 | 0.7 | 7.0473E7 |  |
 |
1.0766E6 | 1.0843E8 | 1.0218E8 | 64.00 | 1 | 130 | 139 | |
| R.QVQSLTC(+57.02)EVDALK.G | Y | Y | 5.97 | 33.74 | 1.1 | 4.0557E7 |  |
 |
1.429E6 | 5.8587E7 | 6.1654E7 | 43.15 | 1 | 322 | 334 | Carbamidomethylation |
| R.DGQVINETSQHHDDLE | Y | Y | 4.56 | 20.66 | 0.8 | 5.5235E6 |  |
 |
1.4999E4 | 1.0065E7 | 9.0179E6 | 64.00 | 1 | 451 | 466 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VYALPEDLVEVKPK.M | Y | Y | 6.75 | 10.74 | 0.5 | 1.4506E7 |  |
 |
2.4822E6 | 1.7812E7 | 2.3874E7 | 9.62 | 2 | 600 | 613 | |
| K.EGIC(+57.02)ALGGTSELSSEGTQHSYSEEEK.Y | Y | Y | 7.63 | 7.53 | 0.8 | 1.1472E7 |  |
 |
2.419E6 | 1.4098E7 | 1.7897E7 | 7.40 | 1 | 101 | 126 | Carbamidomethylation |
| K.MINLSVPDTIDER.A | Y | Y | 4.99 | 14.52 | 3.6 | 7.8186E6 |  |
 |
8.9056E5 | 8.3334E6 | 1.4232E7 | 15.98 | 1 | 169 | 181 | |
| R.IDINMSGFNETDDLKR.A | N | Y | 4.79 | 3.81 | 1.9 | 5.7038E6 |  |
 |
3.0758E6 | 5.3815E6 | 8.6541E6 | 2.81 | 1 | 321 | 336 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NSEPQDQGELFQGVDPR.A | Y | Y | 4.64 | 18.14 | 10.3 | 6.7149E6 |  |
|
1.8734E7 | 1.0053E6 | 4.0517E5 | 46.24 | 1 | 65 | 81 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NSEPQDQGELFQGVDPR.A | Y | Y | 4.64 | 18.14 | 10.3 | 6.7149E6 | |
|
1.8734E7 | 1.0053E6 | 4.0517E5 | 46.24 | 1 | 65 | 81 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ELISNASDALEK.L | Y | Y | 4.75 | 16.16 | 0.5 | 1.419E7 |  |
 |
1.6476E6 | 1.9711E7 | 2.1623E7 | 13.12 | 1 | 143 | 154 | |
| R.AQLLQPTLEINPR.H | Y | Y | 5.92 | 4.91 | 0.4 | 1.3918E7 |  |
 |
4.5207E6 | 1.6181E7 | 2.1051E7 | 4.66 | 1 | 663 | 675 | |
| R.ELGSSVALYSR.K | Y | Y | 4.57 | 6.33 | 0.6 | 7.8057E6 |  |
 |
1.5191E6 | 9.6528E6 | 1.2625E7 | 8.31 | 1 | 386 | 396 | |
| R.NIYYLC(+57.02)APNR.H | N | Y | 4.98 | 3.03 | 3.1 | 7.1899E6 |  |
 |
5.1442E6 | 6.9176E6 | 9.508E6 | 1.85 | 1 | 524 | 533 | Carbamidomethylation |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ELISNASDALEK.L | Y | Y | 4.75 | 16.16 | 0.5 | 1.419E7 | |
|
1.6476E6 | 1.9711E7 | 2.1623E7 | 13.12 | 1 | 117 | 128 | |
| R.AQLLQPTLEINPR.H | Y | Y | 5.92 | 4.91 | 0.4 | 1.3918E7 | |
|
4.5207E6 | 1.6181E7 | 2.1051E7 | 4.66 | 1 | 637 | 649 | |
| R.ELGSSVALYSR.K | Y | Y | 4.57 | 6.33 | 0.6 | 7.8057E6 | |
|
1.5191E6 | 9.6528E6 | 1.2625E7 | 8.31 | 1 | 360 | 370 | |
| R.NIYYLC(+57.02)APNR.H | N | Y | 4.98 | 3.03 | 3.1 | 7.1899E6 | |
|
5.1442E6 | 6.9176E6 | 9.508E6 | 1.85 | 1 | 498 | 507 | Carbamidomethylation |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ELISNASDALEK.L | Y | Y | 4.75 | 16.16 | 0.5 | 1.419E7 | |
|
1.6476E6 | 1.9711E7 | 2.1623E7 | 13.12 | 1 | 93 | 104 | |
| R.AQLLQPTLEINPR.H | Y | Y | 5.92 | 4.91 | 0.4 | 1.3918E7 | |
|
4.5207E6 | 1.6181E7 | 2.1051E7 | 4.66 | 1 | 613 | 625 | |
| R.ELGSSVALYSR.K | Y | Y | 4.57 | 6.33 | 0.6 | 7.8057E6 | |
|
1.5191E6 | 9.6528E6 | 1.2625E7 | 8.31 | 1 | 336 | 346 | |
| R.NIYYLC(+57.02)APNR.H | N | Y | 4.98 | 3.03 | 3.1 | 7.1899E6 | |
|
5.1442E6 | 6.9176E6 | 9.508E6 | 1.85 | 1 | 474 | 483 | Carbamidomethylation |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NLATTVTEEILEK.S | Y | Y | 4.36 | 6.58 | 2.9 | 3.0712E7 |  |
 |
6.368E6 | 3.9397E7 | 4.637E7 | 7.28 | 1 | 347 | 359 | |
| R.STAYEDYYYHPPPR.M | Y | Y | 5.73 | 12.38 | 0.9 | 2.2874E7 |  |
 |
4.7875E6 | 3.4658E7 | 2.9199E7 | 7.24 | 2 | 428 | 441 | |
| R.KYGGPPPDSVYSGVQPGIGTEVFVGK.I | Y | Y | 6.54 | 6.69 | 0.8 | 6.4382E6 |  |
 |
1.9823E6 | 9.0365E6 | 8.2957E6 | 4.56 | 1 | 146 | 171 | |
| R.EFNEEGALSVLQQFK.E | N | Y | 4.05 | 8.25 | 0.6 | 4.4554E6 |  |
 |
8.4487E5 | 7.0695E6 | 5.452E6 | 8.37 | 1 | 70 | 84 | |
| R.GYAFITFC(+57.02)GK.E | N | Y | 4.57 | 6.80 | 0.6 | 3.1158E6 |  |
 |
4.5303E5 | 4.4224E6 | 4.472E6 | 9.87 | 1 | 207 | 216 | Carbamidomethylation |
| K.YGGPPPDSVYSGVQPGIGTEVFVGK.I | N | Y | 5.40 | 17.87 | 1.0 | 2.8042E6 |  |
 |
3.0173E5 | 4.6587E6 | 3.5275E6 | 15.44 | 1 | 147 | 171 | |
| K.TKENILEEFSK.V | N | Y | 5.41 | 9.05 | 0.9 | 2.4184E6 |  |
 |
4.2116E5 | 3.2581E6 | 3.5761E6 | 8.49 | 1 | 258 | 268 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VGEVC(+57.02)HITC(+57.02)KPEYAYGSAGSPPK.I | Y | Y | 7.19 | 5.48 | 0.6 | 2.2782E7 |  |
 |
8.6907E6 | 2.9815E7 | 3.7294E7 | 4.29 | 2 | 99 | 121 | Carbamidomethylation |
| K.LQAFSAAIESC(+57.02)NK.A | Y | Y | 5.67 | 8.22 | 0.5 | 6.5344E6 |  |
 |
2.3091E6 | 5.4595E6 | 1.1835E7 | 5.13 | 1 | 332 | 344 | Carbamidomethylation |
| K.GEHSIVYLKPSYAFGSVGK.E | Y | Y | 6.70 | 5.34 | 0.7 | 6.2885E6 |  |
 |
2.1465E6 | 6.906E6 | 9.813E6 | 4.57 | 1 | 214 | 232 | |
| R.LASHLNLAMC(+57.02)HLK.L | N | Y | 5.44 | 5.29 | 3.9 | 5.8062E6 |  |
 |
1.7905E6 | 6.6901E6 | 8.9379E6 | 4.99 | 1 | 319 | 331 | Carbamidomethylation |
| K.FSFDLGK.G | N | Y | 4.72 | 6.32 | 0.6 | 3.0948E6 |  |
|
7.8414E5 | 3.994E6 | 4.5062E6 | 5.75 | 1 | 77 | 83 | |
| R.VFVHYTGWLLDGTK.F | N | Y | 5.35 | 8.69 | 0.8 | 1.9756E6 |  |
 |
4.1143E5 | 2.749E6 | 2.7665E6 | 6.72 | 1 | 53 | 66 | |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VVEGSFVYK.G | Y | Y | 5.38 | 14.75 | 1.1 | 1.2194E7 |  |
 |
2.6784E7 | 3.5139E6 | 6.2843E6 | 7.62 | 1 | 104 | 112 | |
| R.NPYYGGESSSITPLEELYK.R | Y | Y | 5.47 | 9.36 | 0.8 | 1.0303E7 |  |
 |
2.2135E7 | 3.1209E6 | 5.6528E6 | 7.09 | 1 | 36 | 54 | |
| K.TFEGVDPQTTSMR.D | Y | Y | 5.40 | 9.21 | 1.0 | 6.0493E6 |  |
 |
1.1303E7 | 1.9651E6 | 4.8797E6 | 5.75 | 1 | 157 | 169 | |
| K.QLIC(+57.02)DPSYIPDR.V | N | Y | 7.24 | 9.05 | 0.4 | 5.581E6 |  |
 |
1.1886E7 | 1.4434E6 | 3.4139E6 | 8.23 | 1 | 279 | 290 | Carbamidomethylation |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VVEGSFVYK.G | Y | Y | 5.38 | 14.75 | 1.1 | 1.2194E7 | |
|
2.6784E7 | 3.5139E6 | 6.2843E6 | 7.62 | 1 | 97 | 105 | |
| R.NPYYGGESSSITPLEELYK.R | Y | Y | 5.47 | 9.36 | 0.8 | 1.0303E7 | |
|
2.2135E7 | 3.1209E6 | 5.6528E6 | 7.09 | 1 | 29 | 47 | |
| K.TFEGVDPQTTSMR.D | Y | Y | 5.40 | 9.21 | 1.0 | 6.0493E6 | |
|
1.1303E7 | 1.9651E6 | 4.8797E6 | 5.75 | 1 | 150 | 162 | |
| K.QLIC(+57.02)DPSYIPDR.V | N | Y | 7.24 | 9.05 | 0.4 | 5.581E6 | |
|
1.1886E7 | 1.4434E6 | 3.4139E6 | 8.23 | 1 | 272 | 283 | Carbamidomethylation |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VNQIGSVTESLQAC(+57.02)K.L | Y | Y | 7.98 | 5.95 | 0.4 | 2.332E8 |  |
 |
6.9248E7 | 3.3026E8 | 3.001E8 | 4.77 | 1 | 344 | 358 | Carbamidomethylation |
| K.TIAPALVSK.K | Y | Y | 5.17 | 6.63 | 0.7 | 1.4109E8 |  |
 |
3.9192E7 | 1.9954E8 | 1.8453E8 | 5.09 | 1 | 72 | 80 | |
| R.IEEELGSK.A | Y | Y | 5.30 | 5.81 | 0.6 | 1.0501E8 |  |
 |
3.639E7 | 1.5094E8 | 1.6543E8 | 4.55 | 1 | 413 | 420 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VNQIGSVTESLQAC(+57.02)K.L | Y | Y | 7.98 | 5.95 | 0.4 | 2.332E8 | |
|
6.9248E7 | 3.3026E8 | 3.001E8 | 4.77 | 1 | 344 | 358 | Carbamidomethylation |
| K.TIAPALVSK.K | Y | Y | 5.17 | 6.63 | 0.7 | 1.4109E8 | |
|
3.9192E7 | 1.9954E8 | 1.8453E8 | 5.09 | 1 | 72 | 80 | |
| R.IEEELGSK.A | Y | Y | 5.30 | 5.81 | 0.6 | 1.0501E8 | |
|
3.639E7 | 1.5094E8 | 1.6543E8 | 4.55 | 1 | 413 | 420 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VETGILRPGMVVTFAPVNITTEVK.S | Y | Y | 5.61 | 41.47 | 0.9 | 2.8724E7 |  |
 |
7.9498E7 | 4.1157E6 | 2.5572E6 | 31.09 | 1 | 267 | 290 | |
| K.SGDAAIVEMVPGKPMC(+57.02)VESFSQYPPLGR.F | Y | Y | 3.45 | 10.77 | 4.4 | 8.3514E6 |  |
 |
2.4119E7 | 9.4934E5 | 4.4598E5 | 54.08 | 1 | 396 | 423 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VETGILRPGMVVTFAPVNITTEVK.S | Y | Y | 5.61 | 41.47 | 0.9 | 2.8724E7 | |
|
7.9498E7 | 4.1157E6 | 2.5572E6 | 31.09 | 1 | 267 | 290 | |
| K.SGDAAIVEMVPGKPMC(+57.02)VESFSQYPPLGR.F | Y | Y | 3.45 | 10.77 | 4.4 | 8.3514E6 | |
|
2.4119E7 | 9.4934E5 | 4.4598E5 | 54.08 | 1 | 396 | 423 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.RPTEIC(+57.02)ADPQFIIGGATR.T | Y | Y | 11.94 | 10.75 | 0.5 | 6.9065E6 |  |
 |
1.6122E7 | 1.688E6 | 2.9095E6 | 9.55 | 1 | 77 | 94 | Carbamidomethylation |
| K.LEEEDEDDEDGER.G | Y | Y | 10.89 | 18.13 | 1.2 | 7.386E4 |  |
 |
2.1317E5 | 4.7454E3 | 8.044E3 | 44.92 | 1 | 391 | 403 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M.PGHLQEGFGC(+57.02)VVTNR.F | Y | Y | 5.48 | 9.90 | 2.7 | 4.2583E7 |  |
 |
1.1485E7 | 5.4716E7 | 6.1547E7 | 5.36 | 2 | 2 | 16 | Carbamidomethylation |
| K.EETQPPVALK.K | Y | Y | 4.38 | 9.65 | 2.5 | 1.8027E7 |  |
 |
2.9073E6 | 2.7039E7 | 3.0895E7 | 10.63 | 1 | 93 | 102 | |
| K.SSASAPDVDDPEAFPALA | Y | Y | 5.10 | 4.23 | 0.6 | 1.4437E7 |  |
 |
6.9094E6 | 2.0776E7 | 2.0835E7 | 3.02 | 1 | 390 | 407 | |
| R.GGSGSHNWGTVKDELTESPK.Y | N | Y | 12.25 | 3.29 | 0.9 | 2.0755E6 |  |
 |
1.2292E6 | 2.6045E6 | 3.0439E6 | 2.48 | 1 | 217 | 236 | |
| K.KEETQPPVALK.K | N | Y | 5.09 | 2.56 | 0.9 | 1.7386E6 |  |
 |
1.1794E6 | 2.2267E6 | 2.3663E6 | 2.01 | 1 | 92 | 102 | |
| R.RFEKPLEEK.G | N | Y | 4.21 | 1.72 | 4.0 | 1.8871E5 |  |
 |
1.3009E5 | 2.2831E5 | 2.6479E5 | 2.04 | 1 | 137 | 145 | |
| K.SAAQAAAQTNSNAAGK.Q | N | Y | 23.02 | 6.40 | 0.6 | 2.5997E4 |  |
 |
1.0639E4 | 3.4503E4 | 4.1476E4 | 3.90 | 1 | 53 | 68 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VLTPELYAELR.A | Y | Y | 5.75 | 11.39 | 0.7 | 1.2667E8 |  |
 |
3.3894E7 | 1.4028E8 | 2.0585E8 | 6.07 | 1 | 33 | 43 | |
| R.GTGGVDTAAVGGVFDVSNADR.L | Y | Y | 7.16 | 8.22 | 0.7 | 7.5734E7 |  |
 |
1.8023E7 | 8.7177E7 | 1.22E8 | 6.77 | 1 | 321 | 341 | |
| K.LLIEMEQR.L | Y | Y | 5.76 | 17.19 | 0.6 | 5.9967E7 |  |
 |
7.711E6 | 6.5333E7 | 1.0686E8 | 13.86 | 1 | 359 | 366 | |
| K.DLFDPIIEDR.H | N | Y | 5.45 | 11.52 | 0.6 | 5.5662E7 |  |
 |
8.9534E6 | 7.3033E7 | 8.5E7 | 9.49 | 1 | 87 | 96 | |
| R.GFC(+57.02)LPPHC(+57.02)SR.G | N | Y | 4.60 | 11.50 | 0.8 | 4.5893E7 |  |
 |
9.8801E6 | 5.0726E7 | 8.9755E7 | 9.08 | 1 | 139 | 148 | Carbamidomethylation |
| K.TDLNPDNLQGGDDLDPNYVLSSR.V | N | Y | 6.27 | 14.85 | 0.5 | 5.8811E7 |  |
 |
1.607E7 | 7.0944E7 | 8.9418E7 | 5.56 | 2 | 108 | 130 | |
| K.SM(+15.99)TEAEQQQLIDDHFLFDKPVSPLLLASGMAR.D | N | Y | 4.94 | 7.19 | 2.9 | 1.7528E7 |  |
 |
6.4326E6 | 3.0379E7 | 1.5772E7 | 4.72 | 1 | 178 | 209 | Oxidation (M) |
| K.RGTGGVDTAAVGGVFDVSNADR.L | N | Y | 13.53 | 7.62 | 0.8 | 8.7003E6 |  |
 |
2.4064E6 | 9.1172E6 | 1.4603E7 | 6.07 | 2 | 320 | 341 | |
| R.FPAEDEFPDLSSHNNHMAK.V | N | Y | 5.91 | 0.36 | 1.0 | 3.16E6 |  |
 |
3.1674E6 | 2.9611E6 | 3.3515E6 | 1.13 | 1 | 14 | 32 | |
| total 9 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VLTPELYAELR.A | Y | Y | 5.75 | 11.39 | 0.7 | 1.2667E8 | |
|
3.3894E7 | 1.4028E8 | 2.0585E8 | 6.07 | 1 | 33 | 43 | |
| R.GTGGVDTAAVGGVFDVSNADR.L | Y | Y | 7.16 | 8.22 | 0.7 | 7.5734E7 | |
|
1.8023E7 | 8.7177E7 | 1.22E8 | 6.77 | 1 | 323 | 343 | |
| K.LLIEMEQR.L | Y | Y | 5.76 | 17.19 | 0.6 | 5.9967E7 | |
|
7.711E6 | 6.5333E7 | 1.0686E8 | 13.86 | 1 | 361 | 368 | |
| K.DLFDPIIEDR.H | N | Y | 5.45 | 11.52 | 0.6 | 5.5662E7 | |
|
8.9534E6 | 7.3033E7 | 8.5E7 | 9.49 | 1 | 87 | 96 | |
| R.GFC(+57.02)LPPHC(+57.02)SR.G | N | Y | 4.60 | 11.50 | 0.8 | 4.5893E7 | |
|
9.8801E6 | 5.0726E7 | 8.9755E7 | 9.08 | 1 | 139 | 148 | Carbamidomethylation |
| K.TDLNPDNLQGGDDLDPNYVLSSR.V | N | Y | 6.27 | 14.85 | 0.5 | 5.8811E7 | |
|
1.607E7 | 7.0944E7 | 8.9418E7 | 5.56 | 2 | 108 | 130 | |
| K.SM(+15.99)TEAEQQQLIDDHFLFDKPVSPLLLASGMAR.D | N | Y | 4.94 | 7.19 | 2.9 | 1.7528E7 | |
|
6.4326E6 | 3.0379E7 | 1.5772E7 | 4.72 | 1 | 178 | 209 | Oxidation (M) |
| K.RGTGGVDTAAVGGVFDVSNADR.L | N | Y | 13.53 | 7.62 | 0.8 | 8.7003E6 | |
|
2.4064E6 | 9.1172E6 | 1.4603E7 | 6.07 | 2 | 322 | 343 | |
| R.FPAEDEFPDLSSHNNHMAK.V | N | Y | 5.91 | 0.36 | 1.0 | 3.16E6 | |
|
3.1674E6 | 2.9611E6 | 3.3515E6 | 1.13 | 1 | 14 | 32 | |
| total 9 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.GLGLDESGLAK.Q | Y | Y | 5.18 | 6.84 | 1.2 | 1.3203E7 |  |
 |
3.0202E6 | 1.7761E7 | 1.8828E7 | 6.23 | 1 | 23 | 33 | |
| R.AVLLAGPPGTGK.T | Y | Y | 4.62 | 5.56 | 0.4 | 1.2997E7 |  |
 |
4.7394E6 | 1.6424E7 | 1.7828E7 | 3.76 | 1 | 65 | 76 | |
| R.YSVQLLTPANLLAK.I | Y | Y | 6.07 | 7.31 | 0.4 | 1.1857E7 |  |
 |
5.1795E6 | 1.6264E7 | 1.4128E7 | 3.14 | 1 | 405 | 418 | |
| K.LDPSIFESLQK.E | N | Y | 4.50 | 4.02 | 4.5 | 1.177E7 |  |
 |
5.3932E6 | 1.0803E7 | 1.9112E7 | 3.54 | 1 | 172 | 182 | |
| K.TALALAIAQELGSK.V | N | Y | 4.99 | 6.73 | 0.6 | 1.0674E7 |  |
 |
2.9326E6 | 1.5419E7 | 1.3671E7 | 5.26 | 1 | 77 | 90 | |
| R.GTEDITSPHGIPLDLLDR.V | N | Y | 6.28 | 6.16 | 0.9 | 1.1058E7 |  |
 |
4.4429E6 | 1.4033E7 | 1.4697E7 | 3.31 | 2 | 340 | 357 | |
| K.VPFC(+57.02)PMVGSEVYSTEIK.K | N | Y | 5.38 | 10.04 | 0.5 | 6.7575E6 |  |
 |
1.9749E6 | 8.3694E6 | 9.928E6 | 5.03 | 1 | 91 | 107 | Carbamidomethylation |
| R.VEAGDVIYIEANSGAVK.R | N | Y | 7.69 | 3.95 | 0.7 | 6.6782E6 |  |
 |
2.5627E6 | 8.6779E6 | 8.7941E6 | 3.43 | 1 | 185 | 201 | |
| K.QAASGLVGQENAR.E | N | Y | 4.83 | 5.09 | 0.6 | 4.8662E6 |  |
 |
1.6785E6 | 7.2454E6 | 7.4861E6 | 4.46 | 1 | 34 | 46 | |
| K.TISHVIIGLK.T | N | Y | 5.29 | 13.42 | 0.6 | 3.5836E6 |  |
 |
6.1221E5 | 4.4896E6 | 5.649E6 | 9.23 | 1 | 153 | 162 | |
| K.EHVEEISELFYDAK.S | N | Y | 5.36 | 6.78 | 0.6 | 2.4193E6 |  |
 |
8.6976E5 | 3.6344E6 | 2.7538E6 | 4.18 | 1 | 428 | 441 | |
| K.EVYEGEVTELTPC(+57.02)ETENPMGGYGK.T | N | Y | 6.91 | 15.87 | 1.1 | 1.3656E6 |  |
 |
1.732E5 | 1.8274E6 | 2.0962E6 | 12.10 | 1 | 129 | 152 | Carbamidomethylation |
| R.ALESSIAPIVIFASNR.G | N | Y | 4.59 | 3.23 | 2.5 | 5.3398E6 |  |
 |
2.5899E6 | 8.6373E6 | 6.9721E6 | 3.33 | 2 | 318 | 333 | |
| K.VPFC(+57.02)PM(+15.99)VGSEVYSTEIK.K | N | Y | 5.54 | 13.27 | 1.8 | 7.814E5 |  |
 |
1.4083E5 | 9.94E5 | 1.2094E6 | 8.59 | 1 | 91 | 107 | Carbamidomethylation; Oxidation (M) |
| total 14 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ALIPTTAPQEPETYEDIIR.D | Y | Y | 3.66 | 12.32 | 1.1 | 1.7386E7 |  |
|
5.1642E7 | 5.8849E5 | 3.0358E5 | 64.00 | 1 | 52 | 70 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ALIPTTAPQEPETYEDIIR.D | Y | Y | 3.66 | 12.32 | 1.1 | 1.7386E7 | |
|
5.1642E7 | 5.8849E5 | 3.0358E5 | 64.00 | 1 | 72 | 90 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ALIPTTAPQEPETYEDIIR.D | Y | Y | 3.66 | 12.32 | 1.1 | 1.7386E7 | |
|
5.1642E7 | 5.8849E5 | 3.0358E5 | 64.00 | 1 | 40 | 58 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.GGGGNFGPGPGSNFR.G | Y | Y | 5.94 | 3.83 | 0.8 | 1.239E8 |  |
 |
5.5385E7 | 1.6043E8 | 1.5588E8 | 2.90 | 1 | 214 | 228 | |
| R.GGNFGFGDSR.G | Y | Y | 5.54 | 6.71 | 0.5 | 6.0374E7 |  |
 |
2.4506E7 | 7.1148E7 | 8.5467E7 | 3.49 | 1 | 204 | 213 | |
| K.TLETVPLER.K | N | Y | 5.63 | 8.26 | 0.6 | 1.2401E7 |  |
 |
3.1271E6 | 1.5741E7 | 1.8334E7 | 5.86 | 1 | 4 | 12 | |
| R.NMGGPYGGGNYGPGGSGGSGGYGGR.S | Y | Y | 6.97 | 6.53 | 0.6 | 2.8118E7 |  |
 |
9.5129E6 | 3.4952E7 | 3.989E7 | 4.19 | 2 | 326 | 350 | |
| R.NM(+15.99)GGPYGGGNYGPGGSGGSGGYGGR.S | N | Y | 6.50 | 3.09 | 3.7 | 4.5126E6 |  |
 |
2.9266E6 | 4.9176E6 | 5.8737E6 | 2.01 | 2 | 326 | 350 | Oxidation (M) |
| R.GFGDGYNGYGGGPGGGNFGGSPGYGGGR.G | N | Y | 5.87 | 24.45 | 1.3 | 9.2692E5 |  |
 |
2.7865E4 | 1.1429E6 | 1.6309E6 | 58.53 | 1 | 239 | 266 | |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.DLGLSESGEDVNAAILDESGKK.F | Y | Y | 10.41 | 5.07 | 1.9 | 1.3938E7 |  |
 |
5.2362E6 | 1.517E7 | 2.1406E7 | 4.09 | 2 | 497 | 518 | |
| K.FDVSGYPTIK.I | Y | Y | 6.51 | 6.14 | 0.6 | 1.2714E7 |  |
 |
4.7092E6 | 1.3788E7 | 1.9646E7 | 4.17 | 1 | 165 | 174 | |
| K.FHHTFSTEIAK.F | Y | Y | 3.64 | 5.05 | 3.7 | 6.63E6 |  |
 |
1.4245E6 | 7.9729E6 | 1.2842E7 | 9.02 | 1 | 369 | 379 | |
| K.VEGFPTIYFAPSGDK.K | N | Y | 4.78 | 5.75 | 0.4 | 6.091E6 |  |
 |
2.3964E6 | 7.1567E6 | 8.72E6 | 3.64 | 1 | 630 | 644 | |
| R.SPPIPLAK.V | N | Y | 4.60 | 6.01 | 0.7 | 3.1456E6 |  |
 |
1.3214E6 | 3.2313E6 | 4.884E6 | 3.70 | 1 | 260 | 267 | |
| K.VEGFPTIYFAPSGDKK.N | N | Y | 5.13 | 4.84 | 2.9 | 1.6157E6 |  |
 |
6.8004E5 | 1.624E6 | 2.713E6 | 3.99 | 1 | 630 | 645 | |
| K.DLGLSESGEDVNAAILDESGK.K | N | Y | 6.12 | 6.47 | 1.0 | 8.9093E5 |  |
 |
2.3708E5 | 1.2523E6 | 1.1834E6 | 5.28 | 1 | 497 | 517 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.DLGLSESGEDVNAAILDESGKK.F | Y | Y | 10.41 | 5.07 | 1.9 | 1.3938E7 | |
|
5.2362E6 | 1.517E7 | 2.1406E7 | 4.09 | 2 | 462 | 483 | |
| K.FDVSGYPTIK.I | Y | Y | 6.51 | 6.14 | 0.6 | 1.2714E7 | |
|
4.7092E6 | 1.3788E7 | 1.9646E7 | 4.17 | 1 | 130 | 139 | |
| K.FHHTFSTEIAK.F | Y | Y | 3.64 | 5.05 | 3.7 | 6.63E6 | |
|
1.4245E6 | 7.9729E6 | 1.2842E7 | 9.02 | 1 | 334 | 344 | |
| K.VEGFPTIYFAPSGDK.K | N | Y | 4.78 | 5.75 | 0.4 | 6.091E6 | |
|
2.3964E6 | 7.1567E6 | 8.72E6 | 3.64 | 1 | 595 | 609 | |
| R.SPPIPLAK.V | N | Y | 4.60 | 6.01 | 0.7 | 3.1456E6 | |
|
1.3214E6 | 3.2313E6 | 4.884E6 | 3.70 | 1 | 225 | 232 | |
| K.VEGFPTIYFAPSGDKK.N | N | Y | 5.13 | 4.84 | 2.9 | 1.6157E6 | |
|
6.8004E5 | 1.624E6 | 2.713E6 | 3.99 | 1 | 595 | 610 | |
| K.DLGLSESGEDVNAAILDESGK.K | N | Y | 6.12 | 6.47 | 1.0 | 8.9093E5 | |
|
2.3708E5 | 1.2523E6 | 1.1834E6 | 5.28 | 1 | 462 | 482 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SADTLWDIQK.D | Y | Y | 5.18 | 17.17 | 0.8 | 6.434E7 |  |
 |
4.734E6 | 8.3873E7 | 1.056E8 | 22.31 | 1 | 320 | 329 | |
| K.FIIPQIVK.Y | Y | Y | 4.82 | 21.41 | 0.6 | 5.4362E7 |  |
 |
2.0681E6 | 8.6177E7 | 9.6385E7 | 46.61 | 1 | 120 | 127 | |
| K.GEMMDLQHGSLFLQTPK.I | Y | Y | 5.81 | 44.78 | 0.4 | 1.8349E7 |  |
 |
7.1601E5 | 2.4241E7 | 3.009E7 | 42.02 | 1 | 61 | 77 | |
| K.IVADKDYSVTANSK.I | N | Y | 4.27 | 19.30 | 1.1 | 4.0144E6 |  |
 |
8.5799E4 | 4.7867E6 | 8.3889E6 | 64.00 | 1 | 78 | 91 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M(+42.01)EGHDPKEPEQLR.K | Y | Y | 7.93 | 4.62 | 3.6 | 1.2042E7 | |
|
2.3175E7 | 5.5706E6 | 8.774E6 | 4.16 | 2 | 1 | 13 | Acetylation (N-term) |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M(+42.01)EGHDPKEPEQLR.K | Y | Y | 7.93 | 4.62 | 3.6 | 1.2042E7 | |
|
2.3175E7 | 5.5706E6 | 8.774E6 | 4.16 | 2 | 1 | 13 | Acetylation (N-term) |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LNEHFLNTTDFLDTIK.S | Y | Y | 5.95 | 23.47 | 0.6 | 6.1507E6 |  |
 |
1.3922E7 | 1.6179E6 | 2.9117E6 | 8.61 | 1 | 427 | 442 | |
| K.DLAGC(+57.02)IHGLSNVK.L | Y | Y | 5.62 | 6.87 | 3.2 | 1.8925E6 |  |
 |
2.855E6 | 9.5423E5 | 1.8682E6 | 2.99 | 1 | 414 | 426 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IIPGADADVVVWDPEATK.T | Y | Y | 4.24 | 6.78 | 1.3 | 4.2962E6 |  |
 |
1.0454E7 | 9.8805E5 | 1.4464E6 | 10.58 | 1 | 394 | 411 | |
| K.IPHGVSGVQDR.M | Y | Y | 5.32 | 8.83 | 0.6 | 8.3747E5 |  |
 |
1.8421E6 | 3.3568E5 | 4.186E5 | 5.49 | 1 | 344 | 354 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AVTELNEPLSNEDR.N | Y | Y | 6.62 | 9.09 | 0.7 | 2.7714E7 |  |
 |
6.0041E7 | 9.0344E6 | 1.4067E7 | 6.65 | 1 | 29 | 42 | |
| R.YLAEVASGEK.K | Y | Y | 4.88 | 5.28 | 0.7 | 1.555E7 |  |
 |
3.0664E7 | 5.7958E6 | 1.164E7 | 5.29 | 1 | 133 | 142 | |
| K.NSVVEASEAAYK.E | Y | Y | 6.88 | 6.94 | 0.3 | 1.4223E7 |  |
 |
2.8326E7 | 5.8076E6 | 9.9884E6 | 4.88 | 1 | 144 | 155 | |
| K.QAFDDAIAELDTLNEDSYK.D | N | Y | 5.63 | 9.45 | 1.3 | 8.3129E6 |  |
 |
1.8105E7 | 3.3089E6 | 3.8445E6 | 5.47 | 2 | 199 | 217 | |
| K.KNSVVEASEAAYK.E | N | Y | 4.85 | 11.34 | 0.8 | 1.0664E6 |  |
 |
2.4117E6 | 2.3084E5 | 6.1423E5 | 10.45 | 1 | 143 | 155 | |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ILITTVPPNLR.K | Y | Y | 5.11 | 6.53 | 0.8 | 2.5455E7 |  |
 |
8.4131E6 | 3.2862E7 | 3.509E7 | 4.17 | 1 | 149 | 159 | |
| K.VLQSALAAIR.H | N | Y | 5.17 | 7.98 | 0.6 | 2.0521E7 |  |
 |
4.5967E6 | 2.7531E7 | 2.9437E7 | 6.40 | 1 | 171 | 180 | |
| R.VKPAPDETSFSEALLK.R | Y | Y | 7.22 | 5.10 | 0.6 | 2.1487E7 |  |
|
7.6941E6 | 2.8398E7 | 2.8369E7 | 3.69 | 2 | 18 | 33 | |
| R.WFEENASQSTVK.V | N | Y | 4.57 | 3.64 | 1.6 | 8.8731E6 |  |
 |
3.1257E6 | 1.3614E7 | 9.879E6 | 4.36 | 1 | 184 | 195 | |
| R.NQDLAPNSAEQASILSLVTK.I | Y | Y | 4.23 | 5.76 | 0.6 | 2.3765E7 |  |
 |
6.0243E6 | 4.3019E7 | 2.2252E7 | 7.14 | 2 | 35 | 54 | |
| R.VHTVMTLEQQDMVC(+57.02)YTAQTLVR.I | N | Y | 5.05 | 5.50 | 0.8 | 5.0077E6 |  |
 |
1.7614E6 | 6.3078E6 | 6.9538E6 | 3.95 | 1 | 272 | 293 | Carbamidomethylation |
| K.RNQDLAPNSAEQASILSLVTK.I | N | Y | 9.45 | 3.26 | 0.9 | 1.2868E6 |  |
 |
5.4748E5 | 1.5423E6 | 1.7706E6 | 3.23 | 1 | 34 | 54 | |
| R.KLDPELHLDIK.V | N | Y | 7.79 | 4.79 | 1.5 | 5.8724E5 |  |
 |
1.8108E5 | 7.9025E5 | 7.9039E5 | 4.36 | 1 | 160 | 170 | |
| K.LDPELHLDIK.V | N | Y | 5.61 | 9.94 | 2.7 | 4.82E5 |  |
 |
1.6552E5 | 5.9743E5 | 6.8307E5 | 4.13 | 1 | 161 | 170 | |
| K.ILPTLEAVAALGNK.V | N | Y | 5.04 | 4.34 | 0.6 | 1.6309E7 |  |
 |
6.1995E6 | 2.547E7 | 1.7314E7 | 4.11 | 2 | 102 | 115 | |
| total 10 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ILITTVPPNLR.K | Y | Y | 5.11 | 6.53 | 0.8 | 2.5455E7 | |
|
8.4131E6 | 3.2862E7 | 3.509E7 | 4.17 | 1 | 175 | 185 | |
| K.VLQSALAAIR.H | N | Y | 5.17 | 7.98 | 0.6 | 2.0521E7 | |
|
4.5967E6 | 2.7531E7 | 2.9437E7 | 6.40 | 1 | 197 | 206 | |
| R.VKPAPDETSFSEALLK.R | Y | Y | 7.22 | 5.10 | 0.6 | 2.1487E7 | |
|
7.6941E6 | 2.8398E7 | 2.8369E7 | 3.69 | 2 | 44 | 59 | |
| R.WFEENASQSTVK.V | N | Y | 4.57 | 3.64 | 1.6 | 8.8731E6 | |
|
3.1257E6 | 1.3614E7 | 9.879E6 | 4.36 | 1 | 210 | 221 | |
| R.NQDLAPNSAEQASILSLVTK.I | Y | Y | 4.23 | 5.76 | 0.6 | 2.3765E7 | |
|
6.0243E6 | 4.3019E7 | 2.2252E7 | 7.14 | 2 | 61 | 80 | |
| R.VHTVMTLEQQDMVC(+57.02)YTAQTLVR.I | N | Y | 5.05 | 5.50 | 0.8 | 5.0077E6 | |
|
1.7614E6 | 6.3078E6 | 6.9538E6 | 3.95 | 1 | 298 | 319 | Carbamidomethylation |
| K.RNQDLAPNSAEQASILSLVTK.I | N | Y | 9.45 | 3.26 | 0.9 | 1.2868E6 | |
|
5.4748E5 | 1.5423E6 | 1.7706E6 | 3.23 | 1 | 60 | 80 | |
| R.KLDPELHLDIK.V | N | Y | 7.79 | 4.79 | 1.5 | 5.8724E5 | |
|
1.8108E5 | 7.9025E5 | 7.9039E5 | 4.36 | 1 | 186 | 196 | |
| K.LDPELHLDIK.V | N | Y | 5.61 | 9.94 | 2.7 | 4.82E5 | |
|
1.6552E5 | 5.9743E5 | 6.8307E5 | 4.13 | 1 | 187 | 196 | |
| K.ILPTLEAVAALGNK.V | N | Y | 5.04 | 4.34 | 0.6 | 1.6309E7 | |
|
6.1995E6 | 2.547E7 | 1.7314E7 | 4.11 | 2 | 128 | 141 | |
| total 10 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VLLVPGPEK.E | Y | Y | 4.84 | 8.28 | 1.4 | 1.3629E7 | |
|
2.9501E7 | 4.7883E6 | 6.5973E6 | 6.16 | 1 | 394 | 402 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LGAAPEEESAYVAGER.R | Y | Y | 3.25 | 11.64 | 0.8 | 7.9074E6 |  |
 |
2.3603E7 | 2.1059E5 | 5.581E4 | 64.00 | 1 | 191 | 206 | |
| R.SYQDPSNAQFLESIR.R | Y | Y | 5.68 | 7.04 | 0.7 | 6.6909E6 |  |
 |
1.347E7 | 2.967E6 | 3.636E6 | 4.54 | 1 | 234 | 248 | |
| R.SGQQIVGPPR.K | Y | Y | 5.11 | 7.57 | 0.7 | 5.6461E6 |  |
 |
1.1964E7 | 2.4448E6 | 3.1406E6 | 4.89 | 1 | 136 | 145 | |
| K.SPNELVDDLFK.G | N | Y | 5.92 | 4.44 | 0.5 | 5.0096E6 |  |
 |
9.995E6 | 2.3809E6 | 2.6529E6 | 4.20 | 1 | 148 | 158 | |
| K.EANLLNAVIVQR.L | N | Y | 5.76 | 7.16 | 0.6 | 4.7394E6 |  |
 |
8.4307E6 | 2.5414E6 | 3.246E6 | 3.32 | 1 | 391 | 402 | |
| R.RGEVPAELR.R | N | Y | 4.49 | 5.42 | 0.5 | 4.2953E6 |  |
 |
9.067E6 | 1.7757E6 | 2.487E6 | 5.11 | 1 | 249 | 257 | |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LGAAPEEESAYVAGER.R | Y | Y | 3.25 | 11.64 | 0.8 | 7.9074E6 | |
|
2.3603E7 | 2.1059E5 | 5.581E4 | 64.00 | 1 | 157 | 172 | |
| R.SYQDPSNAQFLESIR.R | Y | Y | 5.68 | 7.04 | 0.7 | 6.6909E6 | |
|
1.347E7 | 2.967E6 | 3.636E6 | 4.54 | 1 | 200 | 214 | |
| R.SGQQIVGPPR.K | Y | Y | 5.11 | 7.57 | 0.7 | 5.6461E6 | |
|
1.1964E7 | 2.4448E6 | 3.1406E6 | 4.89 | 1 | 102 | 111 | |
| K.SPNELVDDLFK.G | N | Y | 5.92 | 4.44 | 0.5 | 5.0096E6 | |
|
9.995E6 | 2.3809E6 | 2.6529E6 | 4.20 | 1 | 114 | 124 | |
| K.EANLLNAVIVQR.L | N | Y | 5.76 | 7.16 | 0.6 | 4.7394E6 | |
|
8.4307E6 | 2.5414E6 | 3.246E6 | 3.32 | 1 | 357 | 368 | |
| R.RGEVPAELR.R | N | Y | 4.49 | 5.42 | 0.5 | 4.2953E6 | |
|
9.067E6 | 1.7757E6 | 2.487E6 | 5.11 | 1 | 215 | 223 | |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LGAAPEEESAYVAGER.R | Y | Y | 3.25 | 11.64 | 0.8 | 7.9074E6 | |
|
2.3603E7 | 2.1059E5 | 5.581E4 | 64.00 | 1 | 159 | 174 | |
| R.SYQDPSNAQFLESIR.R | Y | Y | 5.68 | 7.04 | 0.7 | 6.6909E6 | |
|
1.347E7 | 2.967E6 | 3.636E6 | 4.54 | 1 | 202 | 216 | |
| R.SGQQIVGPPR.K | Y | Y | 5.11 | 7.57 | 0.7 | 5.6461E6 | |
|
1.1964E7 | 2.4448E6 | 3.1406E6 | 4.89 | 1 | 104 | 113 | |
| K.SPNELVDDLFK.G | N | Y | 5.92 | 4.44 | 0.5 | 5.0096E6 | |
|
9.995E6 | 2.3809E6 | 2.6529E6 | 4.20 | 1 | 116 | 126 | |
| K.EANLLNAVIVQR.L | N | Y | 5.76 | 7.16 | 0.6 | 4.7394E6 | |
|
8.4307E6 | 2.5414E6 | 3.246E6 | 3.32 | 1 | 359 | 370 | |
| R.RGEVPAELR.R | N | Y | 4.49 | 5.42 | 0.5 | 4.2953E6 | |
|
9.067E6 | 1.7757E6 | 2.487E6 | 5.11 | 1 | 217 | 225 | |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ALVDHENVISC(+57.02)PHLGASTK.E | Y | Y | 7.73 | 6.26 | 0.5 | 4.5254E7 |  |
 |
1.4249E7 | 5.1011E7 | 7.0504E7 | 4.95 | 2 | 271 | 289 | Carbamidomethylation |
| R.AGTGVDNVDLEAATR.K | Y | Y | 7.27 | 6.70 | 0.8 | 3.1181E7 |  |
 |
1.0124E7 | 3.6698E7 | 4.672E7 | 4.61 | 1 | 76 | 90 | |
| K.VTADVINAAEK.L | Y | Y | 5.68 | 8.50 | 0.7 | 2.7696E7 |  |
 |
9.2468E6 | 3.4192E7 | 4.8199E7 | 5.21 | 1 | 59 | 69 | |
| R.ALQSGQC(+57.02)AGAALDVFTEEPPRDR.A | N | Y | 6.07 | 10.39 | 0.8 | 2.1594E7 |  |
 |
7.9002E6 | 2.1906E7 | 3.4976E7 | 4.43 | 1 | 248 | 270 | Carbamidomethylation |
| K.EELIAELQDC(+57.02)EGLIVR.S | N | Y | 4.81 | 8.57 | 1.4 | 1.6731E7 |  |
 |
3.9181E6 | 2.2243E7 | 2.4031E7 | 6.13 | 1 | 39 | 54 | Carbamidomethylation |
| K.TLGILGLGR.I | N | Y | 4.72 | 19.76 | 0.8 | 1.4055E7 |  |
 |
6.1719E5 | 1.4951E7 | 2.6597E7 | 43.09 | 1 | 147 | 155 | |
| R.ALQSGQC(+57.02)AGAALDVFTEEPPR.D | N | Y | 4.60 | 10.09 | 2.4 | 1.0399E7 |  |
 |
2.2401E6 | 1.4998E7 | 1.3958E7 | 6.70 | 2 | 248 | 268 | Carbamidomethylation |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VGKDELFALEQSC(+57.02)AQVVLQAANER.N | Y | Y | 5.42 | 10.84 | 0.9 | 1.1802E7 |  |
 |
3.169E7 | 1.9011E6 | 1.8141E6 | 17.47 | 1 | 248 | 271 | Carbamidomethylation |
| K.YLTAEAFGFK.V | Y | Y | 3.76 | 4.20 | 6.0 | 6.389E6 |  |
 |
7.711E6 | 9.7982E6 | 1.6577E6 | 5.91 | 1 | 23 | 32 | |
| K.QIWTLEQPPDEAGSAAVC(+57.02)LR.S | Y | Y | 7.53 | 15.20 | 0.9 | 1.8955E6 |  |
 |
5.1503E6 | 1.8056E5 | 3.5549E5 | 28.52 | 1 | 44 | 63 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LAETQEEISAEVAAK.A | Y | Y | 4.78 | 5.09 | 0.8 | 1.3346E7 |  |
 |
4.9293E6 | 1.6389E7 | 1.8718E7 | 3.80 | 1 | 108 | 122 | |
| K.VEQLGAEGNVEESQK.V | Y | Y | 6.05 | 5.15 | 0.5 | 8.1181E6 |  |
 |
3.366E6 | 1.0918E7 | 1.28E7 | 3.80 | 1 | 140 | 154 | |
| K.SHLLNC(+57.02)C(+57.02)PHDVLSGTR.M | Y | Y | 5.80 | 7.42 | 0.6 | 5.7579E6 |  |
 |
2.2118E6 | 7.6719E6 | 9.308E6 | 4.21 | 1 | 38 | 53 | Carbamidomethylation |
| R.AMLDQLMGTSR.D | N | Y | 6.03 | 10.40 | 1.5 | 3.0385E6 |  |
 |
4.7476E5 | 3.844E6 | 4.7969E6 | 10.10 | 1 | 9 | 19 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NVTELNEPLSNEER.N | Y | Y | 5.21 | 6.22 | 0.8 | 2.2652E7 | |
|
4.394E7 | 9.4001E6 | 1.4615E7 | 4.67 | 1 | 29 | 42 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NEAIQAAHDSVAQEGQC(+57.02)R.V | Y | Y | 5.21 | 52.25 | 7.5 | 4.091E7 |  |
|
1.2124E8 | 1.3295E6 | 6.5258E5 | 64.00 | 1 | 136 | 153 | Carbamidomethylation |
| K.LGVAGQWR.F | Y | Y | 3.92 | 4.89 | 6.2 | 1.7066E7 |  |
 |
3.5254E7 | 1.4293E7 | 5.2244E6 | 6.75 | 1 | 20 | 27 | |
| MQLKPMEINPEMLNK.V | N | Y | 5.00 | 3.56 | 3.6 | 1.0513E7 |  |
 |
1.7692E7 | 5.7385E6 | 9.5421E6 | 3.08 | 1 | 1 | 15 | |
| K.QIEELKGQEVSPK.V | Y | Y | 5.83 | 12.16 | 0.6 | 1.1168E7 |  |
 |
2.3914E7 | 2.7962E6 | 7.4934E6 | 8.55 | 2 | 66 | 78 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.QVVNFGPGPAK.L | Y | Y | 4.56 | 4.93 | 0.7 | 9.2399E6 |  |
 |
3.2219E6 | 1.0355E7 | 1.4143E7 | 4.39 | 1 | 6 | 16 | |
| K.FGVIFAGAQK.N | Y | Y | 4.61 | 6.98 | 0.5 | 8.7165E6 |  |
 |
3.3312E6 | 9.1693E6 | 1.3649E7 | 4.10 | 1 | 191 | 200 | |
| K.NVGSAGVTVVIVR.D | Y | Y | 5.66 | 4.87 | 0.4 | 5.4549E6 |  |
 |
2.2759E6 | 5.8606E6 | 8.2283E6 | 3.62 | 1 | 201 | 213 | |
| R.DDLLGFALR.E | N | Y | 4.45 | 15.92 | 0.5 | 4.82E6 |  |
 |
5.9119E5 | 5.6542E6 | 8.3624E6 | 14.14 | 1 | 214 | 222 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IDKTDYMVGSYGPR.A | Y | Y | 5.99 | 6.71 | 0.7 | 9.0379E6 | |
|
1.6693E7 | 3.3907E6 | 7.0301E6 | 4.92 | 1 | 139 | 152 | |
| K.TDYMVGSYGPR.A | N | Y | 5.63 | 3.07 | 0.5 | 8.7553E6 |  |
 |
1.2776E7 | 5.8011E6 | 7.6889E6 | 2.20 | 1 | 142 | 152 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SNIWVAGDAAC(+57.02)FYDIK.L | Y | Y | 4.35 | 5.17 | 3.8 | 2.0127E6 |  |
|
7.9683E5 | 2.3981E6 | 3.2416E6 | 4.07 | 1 | 426 | 441 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IGEEQSPEDAEDGPPELLFIHGGHTAK.I | Y | Y | 7.66 | 4.26 | 1.4 | 2.0521E7 |  |
 |
7.1565E6 | 2.8708E7 | 2.5699E7 | 4.01 | 2 | 350 | 376 | |
| M.A(+42.01)DKEAAFDDAVEER.V | Y | Y | 6.23 | 4.88 | 0.7 | 1.3946E7 |  |
 |
5.6232E6 | 1.6989E7 | 1.9226E7 | 3.42 | 1 | 2 | 15 | Acetylation (N-term) |
| K.GEFGGFGSVSGK.I | Y | Y | 5.31 | 6.56 | 0.7 | 9.672E6 |  |
 |
2.6604E6 | 1.3692E7 | 1.2664E7 | 5.15 | 1 | 103 | 114 | |
| R.YMPQNPC(+57.02)IIATK.T | N | Y | 5.52 | 8.09 | 1.4 | 6.6911E6 |  |
 |
1.5462E6 | 8.2134E6 | 1.0314E7 | 6.67 | 1 | 132 | 143 | Carbamidomethylation |
| R.LVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEK.G | N | Y | 7.19 | 7.57 | 1.2 | 4.8942E6 |  |
 |
1.2698E6 | 8.0017E6 | 5.411E6 | 6.30 | 1 | 66 | 102 | |
| K.HPSKPDPSGEC(+57.02)NPDLR.L | N | Y | 9.20 | 3.94 | 2.3 | 6.0743E6 |  |
 |
2.78E6 | 9.2112E6 | 9.3483E6 | 3.36 | 3 | 157 | 172 | Carbamidomethylation |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IGEEQSPEDAEDGPPELLFIHGGHTAK.I | Y | Y | 7.66 | 4.26 | 1.4 | 2.0521E7 | |
|
7.1565E6 | 2.8708E7 | 2.5699E7 | 4.01 | 2 | 350 | 376 | |
| M.A(+42.01)DKEAAFDDAVEER.V | Y | Y | 6.23 | 4.88 | 0.7 | 1.3946E7 | |
|
5.6232E6 | 1.6989E7 | 1.9226E7 | 3.42 | 1 | 2 | 15 | Acetylation (N-term) |
| K.GEFGGFGSVSGK.I | Y | Y | 5.31 | 6.56 | 0.7 | 9.672E6 | |
|
2.6604E6 | 1.3692E7 | 1.2664E7 | 5.15 | 1 | 103 | 114 | |
| R.YMPQNPC(+57.02)IIATK.T | N | Y | 5.52 | 8.09 | 1.4 | 6.6911E6 | |
|
1.5462E6 | 8.2134E6 | 1.0314E7 | 6.67 | 1 | 132 | 143 | Carbamidomethylation |
| R.LVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEK.G | N | Y | 7.19 | 7.57 | 1.2 | 4.8942E6 | |
|
1.2698E6 | 8.0017E6 | 5.411E6 | 6.30 | 1 | 66 | 102 | |
| K.HPSKPDPSGEC(+57.02)NPDLR.L | N | Y | 9.20 | 3.94 | 2.3 | 6.0743E6 | |
|
2.78E6 | 9.2112E6 | 9.3483E6 | 3.36 | 3 | 157 | 172 | Carbamidomethylation |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AEPEKSEGAAEEQPEPAPAPEQEAAAPGPAAGGEAPK.A | Y | Y | 9.19 | 23.44 | 1.3 | 7.9821E6 |  |
|
2.3719E7 | 3.5838E5 | 9.6958E4 | 64.00 | 1 | 86 | 122 | |
| K.SDAAPAASDSKPSSAEPAPSSK.E | Y | Y | 8.68 | 19.08 | 1.7 | 5.6548E6 |  |
 |
1.6495E7 | 4.3844E5 | 1.8724E5 | 64.00 | 1 | 158 | 179 | |
| K.ETPAASEAPSSAAK.A | Y | Y | 4.43 | 19.02 | 5.3 | 4.8586E6 |  |
|
1.4444E7 | 9.3385E4 | 3.852E4 | 64.00 | 1 | 180 | 193 | |
| K.AGEASAESTGAADGAPQEEGEAK.K | N | Y | 6.59 | 23.56 | 1.8 | 4.1451E6 |  |
 |
1.2113E7 | 3.2667E5 | 1.0315E5 | 64.00 | 1 | 123 | 145 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.QAEILQESR.M | Y | Y | 4.10 | 6.23 | 3.9 | 1.1678E7 |  |
 |
4.1058E6 | 1.1497E7 | 1.9431E7 | 4.73 | 1 | 43 | 51 | |
| R.MMIPDC(+57.02)QR.R | Y | Y | 4.47 | 3.12 | 0.7 | 6.8601E6 |  |
 |
3.157E6 | 8.5209E6 | 1.1033E7 | 3.49 | 1 | 52 | 59 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.QAEILQESR.M | Y | Y | 4.10 | 6.23 | 3.9 | 1.1678E7 | |
|
4.1058E6 | 1.1497E7 | 1.9431E7 | 4.73 | 1 | 125 | 133 | |
| R.MMIPDC(+57.02)QR.R | Y | Y | 4.47 | 3.12 | 0.7 | 6.8601E6 | |
|
3.157E6 | 8.5209E6 | 1.1033E7 | 3.49 | 1 | 134 | 141 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.QAEILQESR.M | Y | Y | 4.10 | 6.23 | 3.9 | 1.1678E7 | |
|
4.1058E6 | 1.1497E7 | 1.9431E7 | 4.73 | 1 | 53 | 61 | |
| R.MMIPDC(+57.02)QR.R | Y | Y | 4.47 | 3.12 | 0.7 | 6.8601E6 | |
|
3.157E6 | 8.5209E6 | 1.1033E7 | 3.49 | 1 | 62 | 69 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.QAEILQESR.M | Y | Y | 4.10 | 6.23 | 3.9 | 1.1678E7 | |
|
4.1058E6 | 1.1497E7 | 1.9431E7 | 4.73 | 1 | 29 | 37 | |
| R.MMIPDC(+57.02)QR.R | Y | Y | 4.47 | 3.12 | 0.7 | 6.8601E6 | |
|
3.157E6 | 8.5209E6 | 1.1033E7 | 3.49 | 1 | 38 | 45 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IEFEQNLAANEQAGPINR.E | Y | Y | 24.01 | 9.50 | 2.1 | 2.7745E5 | |
|
7.2475E4 | 3.7598E5 | 3.8391E5 | 5.30 | 1 | 465 | 482 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IEFEQNLAANEQAGPINR.E | Y | Y | 24.01 | 9.50 | 2.1 | 2.7745E5 | |
|
7.2475E4 | 3.7598E5 | 3.8391E5 | 5.30 | 1 | 470 | 487 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.MTDSFTEQADQVTAEVGK.L | Y | Y | 6.02 | 13.68 | 0.7 | 4.7346E6 |  |
 |
1.2144E7 | 9.0928E5 | 1.1502E6 | 13.36 | 1 | 106 | 123 | |
| K.GAVHQLC(+57.02)QSLAGK.N | Y | Y | 5.37 | 29.15 | 0.6 | 4.1374E6 |  |
 |
1.1086E7 | 5.5993E5 | 9.0572E5 | 19.80 | 1 | 205 | 217 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.MTDSFTEQADQVTAEVGK.L | Y | Y | 6.02 | 13.68 | 0.7 | 4.7346E6 | |
|
1.2144E7 | 9.0928E5 | 1.1502E6 | 13.36 | 1 | 53 | 70 | |
| K.GAVHQLC(+57.02)QSLAGK.N | Y | Y | 5.37 | 29.15 | 0.6 | 4.1374E6 | |
|
1.1086E7 | 5.5993E5 | 9.0572E5 | 19.80 | 1 | 152 | 164 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VIVVGNPANTNC(+57.02)LTASK.S | Y | Y | 6.57 | 3.85 | 0.8 | 4.3975E7 |  |
 |
8.3969E7 | 2.2685E7 | 2.5271E7 | 3.70 | 1 | 126 | 142 | Carbamidomethylation |
| K.FVEGLPINDFSR.E | Y | Y | 10.39 | 5.48 | 0.6 | 2.8266E7 |  |
 |
5.6572E7 | 1.3079E7 | 1.5146E7 | 4.33 | 1 | 299 | 310 | |
| K.EVGVYEALKDDSWLK.G | Y | Y | 6.34 | 1.59 | 0.7 | 1.2537E7 |  |
 |
1.7044E7 | 9.2175E6 | 1.135E7 | 1.85 | 1 | 206 | 220 | |
| K.ENFSC(+57.02)LTR.L | N | Y | 4.20 | 0.44 | 6.6 | 1.2036E7 |  |
 |
1.1942E7 | 1.482E7 | 1.3051E7 | 1.24 | 1 | 150 | 157 | Carbamidomethylation |
| K.NVIIWGNHSSTQYPDVNHAK.V | N | Y | 3.79 | 0.92 | 5.1 | 9.7619E6 |  |
 |
1.3851E7 | 8.8331E6 | 8.8015E6 | 1.57 | 1 | 180 | 199 | |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VIVVGNPANTNC(+57.02)LTASK.S | Y | Y | 6.57 | 3.85 | 0.8 | 4.3975E7 | |
|
8.3969E7 | 2.2685E7 | 2.5271E7 | 3.70 | 1 | 131 | 147 | Carbamidomethylation |
| K.FVEGLPINDFSR.E | Y | Y | 10.39 | 5.48 | 0.6 | 2.8266E7 | |
|
5.6572E7 | 1.3079E7 | 1.5146E7 | 4.33 | 1 | 304 | 315 | |
| K.EVGVYEALKDDSWLK.G | Y | Y | 6.34 | 1.59 | 0.7 | 1.2537E7 | |
|
1.7044E7 | 9.2175E6 | 1.135E7 | 1.85 | 1 | 211 | 225 | |
| K.ENFSC(+57.02)LTR.L | N | Y | 4.20 | 0.44 | 6.6 | 1.2036E7 | |
|
1.1942E7 | 1.482E7 | 1.3051E7 | 1.24 | 1 | 155 | 162 | Carbamidomethylation |
| K.NVIIWGNHSSTQYPDVNHAK.V | N | Y | 3.79 | 0.92 | 5.1 | 9.7619E6 | |
|
1.3851E7 | 8.8331E6 | 8.8015E6 | 1.57 | 1 | 185 | 204 | |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.DTSVEGSEMVPGK.V | Y | Y | 4.61 | 31.22 | 6.9 | 4.6932E6 | |
|
2.4444E5 | 9.9846E6 | 6.3466E6 | 40.85 | 1 | 111 | 123 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.EGGSIPVTLTFQEATGK.N | Y | Y | 5.90 | 6.67 | 0.5 | 5.832E6 |  |
 |
1.1395E7 | 2.469E6 | 3.6314E6 | 4.62 | 1 | 414 | 430 | |
| K.NVMLLPVGSADDGAHSQNEK.L | Y | Y | 7.31 | 8.37 | 0.5 | 2.2716E6 |  |
 |
5.2319E6 | 6.1138E5 | 9.7163E5 | 8.56 | 1 | 431 | 450 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ESYSIYVYK.V | N | Y | 5.12 | 23.34 | 2.0 | 6.3644E7 |  |
 |
2.0479E6 | 1.0104E8 | 8.7842E7 | 49.34 | 1 | 36 | 44 | |
| R.KESYSIYVYK.V | Y | Y | 6.24 | 17.54 | 2.3 | 1.4795E8 | |
|
2.0009E7 | 2.177E8 | 2.0615E8 | 10.88 | 2 | 35 | 44 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ESYSIYVYK.V | N | Y | 5.12 | 23.34 | 2.0 | 6.3644E7 | |
|
2.0479E6 | 1.0104E8 | 8.7842E7 | 49.34 | 1 | 36 | 44 | |
| R.KESYSIYVYK.V | Y | Y | 6.24 | 17.54 | 2.3 | 1.4795E8 | |
|
2.0009E7 | 2.177E8 | 2.0615E8 | 10.88 | 2 | 35 | 44 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.HAC(+57.02)VPVDFEEVHVSSNADEEDIR.N | Y | Y | 10.50 | 5.27 | 1.0 | 4.8167E6 |  |
 |
8.8567E6 | 1.9646E6 | 3.6288E6 | 4.51 | 2 | 79 | 101 | Carbamidomethylation |
| R.HTVTMIPGDGIGPELMLHVK.S | Y | Y | 6.91 | 9.88 | 1.8 | 1.3286E6 |  |
 |
2.4225E6 | 3.4567E5 | 1.2177E6 | 7.01 | 1 | 55 | 74 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.TFVSGAC(+57.02)DASIK.L | Y | Y | 5.48 | 10.15 | 0.6 | 7.1772E6 |  |
 |
1.4479E7 | 2.6313E6 | 4.4212E6 | 5.50 | 1 | 198 | 209 | Carbamidomethylation |
| R.KAC(+57.02)GDSTLTQITAGLDPVGR.I | Y | Y | 5.71 | 8.90 | 0.7 | 3.0184E6 |  |
 |
6.7072E6 | 8.0873E5 | 1.5393E6 | 8.29 | 1 | 23 | 42 | Carbamidomethylation |
| K.AC(+57.02)GDSTLTQITAGLDPVGR.I | N | Y | 5.37 | 8.75 | 2.9 | 2.9797E6 |  |
 |
5.6963E6 | 1.7017E6 | 1.5411E6 | 3.70 | 1 | 24 | 42 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.STGEAFVQFASK.E | Y | Y | 6.48 | 8.65 | 0.6 | 1.0766E7 |  |
 |
2.2022E6 | 1.7177E7 | 1.292E7 | 7.80 | 1 | 56 | 67 | |
| R.ATGEADVEFVTHEDAVAAMSK.D | Y | Y | 4.16 | 7.94 | 0.7 | 6.6906E6 |  |
 |
1.0168E6 | 1.1119E7 | 7.9364E6 | 10.93 | 1 | 218 | 238 | |
| R.VHIDIGADGR.A | Y | Y | 3.81 | 2.93 | 2.5 | 4.4733E6 |  |
 |
1.9905E6 | 7.6343E6 | 5.7035E6 | 3.84 | 1 | 208 | 217 | |
| R.GGGGSGGYYGQGGMSGGGWR.G | N | Y | 7.35 | 10.66 | 0.9 | 7.7326E5 |  |
 |
6.5366E4 | 1.3085E6 | 9.9495E5 | 20.02 | 1 | 309 | 328 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.TPYTDVNIVTIR.E | Y | Y | 5.56 | 6.95 | 1.6 | 1.2331E7 |  |
 |
2.0953E7 | 5.7622E6 | 1.0278E7 | 3.64 | 1 | 135 | 146 | |
| R.ENTEGEYSGIEHVIVDGVVQSIK.L | Y | Y | 6.89 | 7.23 | 2.2 | 1.0685E7 |  |
 |
2.161E7 | 5.3925E6 | 5.0539E6 | 4.28 | 2 | 147 | 169 | |
| K.TPIAAGHPSMNLLLR.K | Y | Y | 8.55 | 5.02 | 0.6 | 7.076E6 |  |
 |
1.3147E7 | 2.3188E6 | 5.7622E6 | 5.67 | 2 | 101 | 115 | |
| R.IAEFAFEYAR.N | N | Y | 4.87 | 5.21 | 0.6 | 5.4246E6 |  |
 |
8.5045E6 | 2.915E6 | 4.8541E6 | 2.92 | 1 | 179 | 188 | |
| K.C(+57.02)SDFTEEIC(+57.02)R.R | N | Y | 4.62 | 4.36 | 1.6 | 2.4751E6 |  |
 |
4.2839E6 | 1.3153E6 | 1.8261E6 | 3.26 | 1 | 351 | 360 | Carbamidomethylation |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.TPYTDVNIVTIR.E | Y | Y | 5.56 | 6.95 | 1.6 | 1.2331E7 | |
|
2.0953E7 | 5.7622E6 | 1.0278E7 | 3.64 | 1 | 153 | 164 | |
| R.ENTEGEYSGIEHVIVDGVVQSIK.L | Y | Y | 6.89 | 7.23 | 2.2 | 1.0685E7 | |
|
2.161E7 | 5.3925E6 | 5.0539E6 | 4.28 | 2 | 165 | 187 | |
| K.TPIAAGHPSMNLLLR.K | Y | Y | 8.55 | 5.02 | 0.6 | 7.076E6 | |
|
1.3147E7 | 2.3188E6 | 5.7622E6 | 5.67 | 2 | 119 | 133 | |
| R.IAEFAFEYAR.N | N | Y | 4.87 | 5.21 | 0.6 | 5.4246E6 | |
|
8.5045E6 | 2.915E6 | 4.8541E6 | 2.92 | 1 | 197 | 206 | |
| K.C(+57.02)SDFTEEIC(+57.02)R.R | N | Y | 4.62 | 4.36 | 1.6 | 2.4751E6 | |
|
4.2839E6 | 1.3153E6 | 1.8261E6 | 3.26 | 1 | 369 | 378 | Carbamidomethylation |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SEPTQALELTEDDIKEDGIVPLR.Y | Y | Y | 5.28 | 11.28 | 0.4 | 1.5734E7 |  |
 |
3.45E7 | 7.3996E6 | 5.3021E6 | 6.51 | 1 | 212 | 234 | |
| M.VGVKPVGSDPDFQPELSGAGSR.L | Y | Y | 8.20 | 7.36 | 0.5 | 1.4754E7 |  |
 |
3.4091E7 | 5.2974E6 | 4.8732E6 | 7.00 | 1 | 2 | 23 | |
| R.IDQYQGADAVGLEEK.I | Y | Y | 5.56 | 11.62 | 1.1 | 6.641E6 |  |
 |
1.4166E7 | 2.6476E6 | 3.1092E6 | 5.35 | 1 | 88 | 102 | |
| K.IFINLPR.S | N | Y | 4.18 | 1.76 | 0.8 | 5.7953E6 |  |
 |
8.3134E6 | 4.0004E6 | 5.072E6 | 2.08 | 1 | 196 | 202 | |
| K.AGC(+57.02)EC(+57.02)LNESDEHGFDNC(+57.02)LR.K | N | Y | 14.75 | 8.62 | 0.6 | 5.5264E6 |  |
 |
1.1283E7 | 2.62E6 | 2.676E6 | 4.31 | 1 | 133 | 151 | Carbamidomethylation |
| K.QHLENDPGSNEDTDIPK.G | N | Y | 5.28 | 9.21 | 0.8 | 2.941E6 |  |
 |
6.6619E6 | 1.1405E6 | 1.3168E6 | 5.84 | 2 | 105 | 121 | |
| K.FQNVNSVTLFVQSNQGEEETTR.I | N | Y | 7.63 | 8.91 | 1.2 | 3.2075E6 |  |
 |
7.8017E6 | 8.2084E5 | 1E6 | 9.50 | 2 | 238 | 259 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SEPTQALELTEDDIKEDGIVPLR.Y | Y | Y | 5.28 | 11.28 | 0.4 | 1.5734E7 | |
|
3.45E7 | 7.3996E6 | 5.3021E6 | 6.51 | 1 | 212 | 234 | |
| M.VGVKPVGSDPDFQPELSGAGSR.L | Y | Y | 8.20 | 7.36 | 0.5 | 1.4754E7 | |
|
3.4091E7 | 5.2974E6 | 4.8732E6 | 7.00 | 1 | 2 | 23 | |
| R.IDQYQGADAVGLEEK.I | Y | Y | 5.56 | 11.62 | 1.1 | 6.641E6 | |
|
1.4166E7 | 2.6476E6 | 3.1092E6 | 5.35 | 1 | 88 | 102 | |
| K.IFINLPR.S | N | Y | 4.18 | 1.76 | 0.8 | 5.7953E6 | |
|
8.3134E6 | 4.0004E6 | 5.072E6 | 2.08 | 1 | 196 | 202 | |
| K.AGC(+57.02)EC(+57.02)LNESDEHGFDNC(+57.02)LR.K | N | Y | 14.75 | 8.62 | 0.6 | 5.5264E6 | |
|
1.1283E7 | 2.62E6 | 2.676E6 | 4.31 | 1 | 133 | 151 | Carbamidomethylation |
| K.QHLENDPGSNEDTDIPK.G | N | Y | 5.28 | 9.21 | 0.8 | 2.941E6 | |
|
6.6619E6 | 1.1405E6 | 1.3168E6 | 5.84 | 2 | 105 | 121 | |
| K.FQNVNSVTLFVQSNQGEEETTR.I | N | Y | 7.63 | 8.91 | 1.2 | 3.2075E6 | |
|
7.8017E6 | 8.2084E5 | 1E6 | 9.50 | 2 | 238 | 259 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SEPTQALELTEDDIKEDGIVPLR.Y | Y | Y | 5.28 | 11.28 | 0.4 | 1.5734E7 | |
|
3.45E7 | 7.3996E6 | 5.3021E6 | 6.51 | 1 | 212 | 234 | |
| M.VGVKPVGSDPDFQPELSGAGSR.L | Y | Y | 8.20 | 7.36 | 0.5 | 1.4754E7 | |
|
3.4091E7 | 5.2974E6 | 4.8732E6 | 7.00 | 1 | 2 | 23 | |
| R.IDQYQGADAVGLEEK.I | Y | Y | 5.56 | 11.62 | 1.1 | 6.641E6 | |
|
1.4166E7 | 2.6476E6 | 3.1092E6 | 5.35 | 1 | 88 | 102 | |
| K.IFINLPR.S | N | Y | 4.18 | 1.76 | 0.8 | 5.7953E6 | |
|
8.3134E6 | 4.0004E6 | 5.072E6 | 2.08 | 1 | 196 | 202 | |
| K.AGC(+57.02)EC(+57.02)LNESDEHGFDNC(+57.02)LR.K | N | Y | 14.75 | 8.62 | 0.6 | 5.5264E6 | |
|
1.1283E7 | 2.62E6 | 2.676E6 | 4.31 | 1 | 133 | 151 | Carbamidomethylation |
| K.QHLENDPGSNEDTDIPK.G | N | Y | 5.28 | 9.21 | 0.8 | 2.941E6 | |
|
6.6619E6 | 1.1405E6 | 1.3168E6 | 5.84 | 2 | 105 | 121 | |
| K.FQNVNSVTLFVQSNQGEEETTR.I | N | Y | 7.63 | 8.91 | 1.2 | 3.2075E6 | |
|
7.8017E6 | 8.2084E5 | 1E6 | 9.50 | 2 | 238 | 259 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SEPTQALELTEDDIKEDGIVPLR.Y | Y | Y | 5.28 | 11.28 | 0.4 | 1.5734E7 | |
|
3.45E7 | 7.3996E6 | 5.3021E6 | 6.51 | 1 | 212 | 234 | |
| M.VGVKPVGSDPDFQPELSGAGSR.L | Y | Y | 8.20 | 7.36 | 0.5 | 1.4754E7 | |
|
3.4091E7 | 5.2974E6 | 4.8732E6 | 7.00 | 1 | 2 | 23 | |
| R.IDQYQGADAVGLEEK.I | Y | Y | 5.56 | 11.62 | 1.1 | 6.641E6 | |
|
1.4166E7 | 2.6476E6 | 3.1092E6 | 5.35 | 1 | 88 | 102 | |
| K.IFINLPR.S | N | Y | 4.18 | 1.76 | 0.8 | 5.7953E6 | |
|
8.3134E6 | 4.0004E6 | 5.072E6 | 2.08 | 1 | 196 | 202 | |
| K.AGC(+57.02)EC(+57.02)LNESDEHGFDNC(+57.02)LR.K | N | Y | 14.75 | 8.62 | 0.6 | 5.5264E6 | |
|
1.1283E7 | 2.62E6 | 2.676E6 | 4.31 | 1 | 133 | 151 | Carbamidomethylation |
| K.QHLENDPGSNEDTDIPK.G | N | Y | 5.28 | 9.21 | 0.8 | 2.941E6 | |
|
6.6619E6 | 1.1405E6 | 1.3168E6 | 5.84 | 2 | 105 | 121 | |
| K.FQNVNSVTLFVQSNQGEEETTR.I | N | Y | 7.63 | 8.91 | 1.2 | 3.2075E6 | |
|
7.8017E6 | 8.2084E5 | 1E6 | 9.50 | 2 | 238 | 259 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.DQLQTFSEEHPVLLTEAPLNPSK.N | Y | Y | 6.37 | 7.99 | 6.1 | 2.8965E6 |  |
 |
6.2271E6 | 1.3894E6 | 1.073E6 | 5.80 | 1 | 94 | 116 | |
| R.AC(+57.02)YLSINPQKDEALETEK.V | Y | Y | 18.58 | 21.67 | 2.7 | 9.6561E5 |  |
 |
2.1839E6 | 2.2561E5 | 4.8732E5 | 9.68 | 1 | 218 | 235 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NLEGYVGFANLPNQVYR.K | Y | Y | 6.30 | 6.96 | 1.4 | 1.4119E6 | |
|
3.4403E6 | 5.6033E5 | 1.5013E6 | 6.14 | 1 | 17 | 33 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NLEGYVGFANLPNQVYR.K | Y | Y | 6.30 | 6.96 | 1.4 | 1.4119E6 | |
|
3.4403E6 | 5.6033E5 | 1.5013E6 | 6.14 | 1 | 26 | 42 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NLEGYVGFANLPNQVYR.K | Y | Y | 6.30 | 6.96 | 1.4 | 1.4119E6 | |
|
3.4403E6 | 5.6033E5 | 1.5013E6 | 6.14 | 1 | 25 | 41 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NLEGYVGFANLPNQVYR.K | Y | Y | 6.30 | 6.96 | 1.4 | 1.4119E6 | |
|
3.4403E6 | 5.6033E5 | 1.5013E6 | 6.14 | 1 | 30 | 46 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M.A(+42.01)SGVQVADEVC(+57.02)R.I | Y | Y | 5.12 | 12.67 | 0.5 | 2.2029E7 |  |
 |
5.4932E7 | 4.9123E6 | 6.2443E6 | 11.18 | 1 | 2 | 13 | Acetylation (N-term); Carbamidomethylation |
| R.YALYDASFETK.E | Y | Y | 4.65 | 12.06 | 5.7 | 1.5204E7 |  |
 |
3.8338E7 | 3.8857E6 | 3.3887E6 | 11.31 | 1 | 82 | 92 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SLSLGGHVGFDSLPDQLVSK.S | Y | Y | 5.51 | 8.64 | 0.6 | 1.667E6 | |
|
4.1251E6 | 4.1247E5 | 4.6337E5 | 10.00 | 1 | 18 | 37 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SLSLGGHVGFDSLPDQLVSK.S | Y | Y | 5.51 | 8.64 | 0.6 | 1.667E6 | |
|
4.1251E6 | 4.1247E5 | 4.6337E5 | 10.00 | 1 | 18 | 37 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SLSLGGHVGFDSLPDQLVSK.S | Y | Y | 5.51 | 8.64 | 0.6 | 1.667E6 | |
|
4.1251E6 | 4.1247E5 | 4.6337E5 | 10.00 | 1 | 16 | 35 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SLSLGGHVGFDSLPDQLVSK.S | Y | Y | 5.51 | 8.64 | 0.6 | 1.667E6 | |
|
4.1251E6 | 4.1247E5 | 4.6337E5 | 10.00 | 1 | 43 | 62 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SAVDYNTC(+57.02)AGVWSQDK.W | Y | Y | 9.39 | 9.72 | 0.9 | 1.4426E6 | |
|
1.7783E5 | 2.2149E6 | 1.935E6 | 12.46 | 1 | 475 | 490 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.TGEAYVQFEEPEMANQALLK.H | Y | Y | 6.30 | 13.55 | 1.3 | 1.0077E6 | |
|
8.6128E4 | 1.5015E6 | 1.4355E6 | 17.43 | 1 | 435 | 454 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.FLFSLFGQK.H | Y | Y | 3.58 | 4.06 | 0.5 | 1.5771E6 | |
|
2.6322E6 | 2.5379E6 | 3.9153E5 | 6.72 | 1 | 216 | 224 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.GEVGLLFTNR.T | Y | Y | 4.14 | 8.42 | 6.5 | 9.5465E6 |  |
 |
1.0724E6 | 1.8416E7 | 9.1507E6 | 17.17 | 1 | 98 | 107 | |
| K.GVVTLLSDYEVC(+57.02)K.E | Y | Y | 3.82 | 4.60 | 1.2 | 7.6042E6 |  |
 |
1.9145E6 | 1.3926E7 | 1.0572E7 | 7.27 | 1 | 165 | 177 | Carbamidomethylation |
| R.SPSDEYKDNLHQVSK.K | Y | Y | 6.26 | 18.57 | 2.6 | 2.4196E6 |  |
 |
6.6837E5 | 4.3799E6 | 3.3057E6 | 6.55 | 1 | 80 | 94 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AEQINQAAGEASAVLAK.A | Y | Y | 6.66 | 5.72 | 0.7 | 4.6161E6 |  |
 |
1.5459E6 | 6.6949E6 | 5.6076E6 | 4.33 | 1 | 234 | 250 | |
| K.ASYGVEDPEYAVTQLAQTTMR.S | Y | Y | 6.54 | 11.92 | 1.5 | 1.582E6 |  |
 |
2.0971E5 | 2.4883E6 | 2.048E6 | 11.87 | 1 | 115 | 135 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.YVAVMPPHIGDQPLTGAYTVTLDGR.G | Y | Y | 5.71 | 7.21 | 1.5 | 4.5639E6 | |
|
9.5764E6 | 2.1782E6 | 1.9372E6 | 4.94 | 1 | 146 | 170 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.YVAVMPPHIGDQPLTGAYTVTLDGR.G | Y | Y | 5.71 | 7.21 | 1.5 | 4.5639E6 | |
|
9.5764E6 | 2.1782E6 | 1.9372E6 | 4.94 | 1 | 146 | 170 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NLVTGDHIPTPQDLPQR.K | Y | Y | 7.97 | 4.62 | 2.9 | 1.0409E7 |  |
 |
4.804E6 | 1.036E7 | 1.6064E7 | 3.34 | 2 | 90 | 106 | |
| K.QEEENPAEETGEEKQDTQEK.E | Y | Y | 23.38 | 8.80 | 2.3 | 5.6609E5 |  |
 |
2.3059E5 | 2.6349E5 | 1.2701E6 | 5.51 | 1 | 5 | 24 | |
| K.QEEENPAEETGEEK.Q | N | Y | 4.93 | 10.19 | 1.4 | 4.2077E5 |  |
 |
1.0317E5 | 2.2262E5 | 9.3653E5 | 9.08 | 1 | 5 | 18 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.EWNLPPNAPAC(+57.02)MER.Q | Y | Y | 3.24 | 5.62 | 1.5 | 2.1428E6 | |
|
2.1183E5 | 2.7362E6 | 3.4803E6 | 16.43 | 1 | 16 | 29 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.QAQAAVLAVLPR.L | Y | Y | 7.06 | 5.95 | 0.5 | 2.0667E6 | |
|
5.5388E5 | 3.2654E6 | 2.5194E6 | 5.90 | 1 | 111 | 122 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.GDVTAEEAAGASPAK.A | Y | Y | 5.32 | 14.98 | 0.4 | 1.4217E7 |  |
 |
2.4683E6 | 2.3177E7 | 2.2799E7 | 9.39 | 1 | 11 | 25 | |
| K.LSGLSFK.R | Y | Y | 4.43 | 12.81 | 0.9 | 5.8331E6 |  |
 |
3.0242E5 | 8.7193E6 | 8.4776E6 | 28.83 | 1 | 100 | 106 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AVQLYQQTANVFENEER.L | Y | Y | 6.70 | 7.70 | 1.0 | 6.95E5 | |
|
1.7447E6 | 1.9438E5 | 1.9456E5 | 8.98 | 1 | 127 | 143 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.EAAASGLPLMVIIHK.S | Y | Y | 5.31 | 7.91 | 0.8 | 2.1006E6 | |
|
5.4672E5 | 2.5673E6 | 3.1877E6 | 5.83 | 1 | 47 | 61 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.EAAASGLPLMVIIHK.S | Y | Y | 5.31 | 7.91 | 0.8 | 2.1006E6 | |
|
5.4672E5 | 2.5673E6 | 3.1877E6 | 5.83 | 1 | 53 | 67 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.FYC(+57.02)DYC(+57.02)DTYLTHDSPSVR.K | Y | Y | 6.30 | 4.99 | 0.6 | 1.2582E7 |  |
 |
4.5667E6 | 1.8858E7 | 1.432E7 | 4.13 | 1 | 4 | 21 | Carbamidomethylation |
| K.WMEEQAQSLIDK.T | Y | Y | 5.68 | 4.78 | 2.6 | 5.4234E6 |  |
 |
2.5129E6 | 7.3715E6 | 6.3858E6 | 2.93 | 1 | 41 | 52 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.FYC(+57.02)DYC(+57.02)DTYLTHDSPSVR.K | Y | Y | 6.30 | 4.99 | 0.6 | 1.2582E7 | |
|
4.5667E6 | 1.8858E7 | 1.432E7 | 4.13 | 1 | 4 | 21 | Carbamidomethylation |
| K.WMEEQAQSLIDK.T | Y | Y | 5.68 | 4.78 | 2.6 | 5.4234E6 | |
|
2.5129E6 | 7.3715E6 | 6.3858E6 | 2.93 | 1 | 41 | 52 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ASSAAGLTAAVVR.D | Y | Y | 5.65 | 4.21 | 3.6 | 5.3007E6 |  |
 |
2.372E6 | 5.9959E6 | 7.5343E6 | 3.18 | 1 | 423 | 435 | |
| K.DFYVAFQDLPTR.H | Y | Y | 4.26 | 7.91 | 1.8 | 3.346E6 |  |
 |
4.4222E5 | 4.6828E6 | 4.9128E6 | 11.11 | 1 | 109 | 120 | |
| K.ELRDEEQTAESIK.N | Y | Y | 4.71 | 8.37 | 1.0 | 2.134E6 |  |
 |
4.4868E5 | 3.7191E6 | 3.1639E6 | 8.29 | 1 | 314 | 326 | |
| R.C(+57.02)DFTGTLIVVPDVSK.L | N | Y | 8.38 | 2.56 | 1.3 | 8.8346E5 |  |
 |
4.5803E5 | 1.1594E6 | 1.033E6 | 2.53 | 1 | 242 | 256 | Carbamidomethylation |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.HNQLPLVIEFTEQTAPK.I | Y | Y | 7.64 | 3.42 | 0.6 | 2.1155E7 |  |
 |
3.5627E7 | 1.2389E7 | 1.5449E7 | 2.88 | 2 | 233 | 249 | |
| K.VDATEESDLAQQYGVR.G | Y | Y | 5.68 | 4.47 | 0.7 | 1.7906E7 |  |
 |
3.0478E7 | 1.0937E7 | 1.2302E7 | 2.79 | 1 | 84 | 99 | |
| R.LITLEEEMTK.Y | N | Y | 4.12 | 1.20 | 0.6 | 1.5057E7 |  |
 |
2.1329E7 | 1.2693E7 | 1.4323E7 | 1.68 | 1 | 319 | 328 | |
| K.THILLFLPK.S | N | Y | 4.86 | 4.26 | 0.6 | 1.4073E7 |  |
 |
2.2877E7 | 1.0147E7 | 9.1955E6 | 2.49 | 1 | 257 | 265 | |
| K.LGETYKDHENIVIAK.M | Y | Y | 8.31 | 3.23 | 1.1 | 1.8799E7 |  |
 |
3.4211E7 | 1.063E7 | 1.4231E7 | 3.22 | 3 | 412 | 426 | |
| K.MDSTANEVEAVK.V | N | Y | 6.00 | 2.79 | 0.5 | 8.7116E6 |  |
 |
1.4222E7 | 5.9769E6 | 7.4306E6 | 2.38 | 1 | 427 | 438 | |
| K.IKPHLMSQELPEDWDKQPVK.V | N | Y | 5.79 | 7.17 | 2.3 | 7.5179E6 |  |
 |
1.4765E7 | 3.2313E6 | 4.5577E6 | 4.57 | 1 | 353 | 372 | |
| R.ILEFFGLK.K | N | Y | 5.60 | 1.06 | 0.7 | 6.493E6 |  |
 |
7.4062E6 | 5.4008E6 | 6.6722E6 | 1.37 | 1 | 303 | 310 | |
| K.YQLDKDGVVLFK.K | N | Y | 7.09 | 5.28 | 0.7 | 8.4258E6 |  |
 |
1.5079E7 | 4.0763E6 | 6.1226E6 | 3.70 | 2 | 198 | 209 | |
| R.EADDIVNWLK.K | N | Y | 5.06 | 2.80 | 3.8 | 4.6845E6 |  |
 |
2.6642E6 | 5.416E6 | 5.9734E6 | 2.24 | 1 | 123 | 132 | |
| K.DHENIVIAK.M | N | Y | 4.21 | 0.99 | 3.9 | 2.4501E6 |  |
 |
3.4645E6 | 2.1515E6 | 2.2721E6 | 1.61 | 1 | 418 | 426 | |
| total 11 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.HNQLPLVIEFTEQTAPK.I | Y | Y | 7.64 | 3.42 | 0.6 | 2.1155E7 | |
|
3.5627E7 | 1.2389E7 | 1.5449E7 | 2.88 | 2 | 206 | 222 | |
| K.VDATEESDLAQQYGVR.G | Y | Y | 5.68 | 4.47 | 0.7 | 1.7906E7 | |
|
3.0478E7 | 1.0937E7 | 1.2302E7 | 2.79 | 1 | 57 | 72 | |
| R.LITLEEEMTK.Y | N | Y | 4.12 | 1.20 | 0.6 | 1.5057E7 | |
|
2.1329E7 | 1.2693E7 | 1.4323E7 | 1.68 | 1 | 292 | 301 | |
| K.THILLFLPK.S | N | Y | 4.86 | 4.26 | 0.6 | 1.4073E7 | |
|
2.2877E7 | 1.0147E7 | 9.1955E6 | 2.49 | 1 | 230 | 238 | |
| K.LGETYKDHENIVIAK.M | Y | Y | 8.31 | 3.23 | 1.1 | 1.8799E7 | |
|
3.4211E7 | 1.063E7 | 1.4231E7 | 3.22 | 3 | 385 | 399 | |
| K.MDSTANEVEAVK.V | N | Y | 6.00 | 2.79 | 0.5 | 8.7116E6 | |
|
1.4222E7 | 5.9769E6 | 7.4306E6 | 2.38 | 1 | 400 | 411 | |
| K.IKPHLMSQELPEDWDKQPVK.V | N | Y | 5.79 | 7.17 | 2.3 | 7.5179E6 | |
|
1.4765E7 | 3.2313E6 | 4.5577E6 | 4.57 | 1 | 326 | 345 | |
| R.ILEFFGLK.K | N | Y | 5.60 | 1.06 | 0.7 | 6.493E6 | |
|
7.4062E6 | 5.4008E6 | 6.6722E6 | 1.37 | 1 | 276 | 283 | |
| K.YQLDKDGVVLFK.K | N | Y | 7.09 | 5.28 | 0.7 | 8.4258E6 | |
|
1.5079E7 | 4.0763E6 | 6.1226E6 | 3.70 | 2 | 171 | 182 | |
| R.EADDIVNWLK.K | N | Y | 5.06 | 2.80 | 3.8 | 4.6845E6 | |
|
2.6642E6 | 5.416E6 | 5.9734E6 | 2.24 | 1 | 96 | 105 | |
| K.DHENIVIAK.M | N | Y | 4.21 | 0.99 | 3.9 | 2.4501E6 | |
|
3.4645E6 | 2.1515E6 | 2.2721E6 | 1.61 | 1 | 391 | 399 | |
| total 11 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ASVTVGGEQISAIGR.G | Y | Y | 7.26 | 6.42 | 0.5 | 5.6851E6 |  |
 |
1.1734E7 | 2.458E6 | 2.8632E6 | 4.77 | 1 | 11 | 25 | |
| R.SASSGAEGDVSSEREP | Y | Y | 6.21 | 8.15 | 1.1 | 1.6384E6 |  |
 |
3.346E6 | 7.4531E5 | 1.0102E6 | 4.49 | 1 | 194 | 209 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.FGQGGAGPVGGQGPR.G | Y | Y | 5.77 | 4.07 | 0.6 | 2.0859E7 |  |
 |
9.8325E6 | 3.2901E7 | 2.807E7 | 3.35 | 1 | 659 | 673 | |
| R.LFVGNLPADITEDEFKR.L | Y | Y | 5.75 | 6.30 | 0.8 | 2.0305E7 |  |
|
8.8972E6 | 2.498E7 | 2.7039E7 | 3.04 | 1 | 291 | 307 | |
| K.YGEPGEVFINK.G | N | Y | 5.48 | 6.35 | 1.4 | 2.0254E7 |  |
 |
8.5833E6 | 2.6568E7 | 2.5612E7 | 3.10 | 1 | 312 | 322 | |
| K.DKLESEMEDAYHEHQANLLR.Q | Y | Y | 6.99 | 4.59 | 1.2 | 2.0349E7 |  |
|
8.0212E6 | 2.6352E7 | 2.687E7 | 3.35 | 2 | 509 | 528 | |
| R.FAQHGTFEYEYSQR.W | N | Y | 6.55 | 5.31 | 0.7 | 1.9129E7 |  |
 |
6.5484E6 | 2.6109E7 | 2.4729E7 | 3.99 | 2 | 472 | 485 | |
| R.FATHAAALSVR.N | N | Y | 4.83 | 6.17 | 5.3 | 1.6448E7 |  |
 |
5.9874E6 | 1.7724E7 | 3.0062E7 | 5.02 | 1 | 358 | 368 | |
| R.LFVGNLPADITEDEFK.R | N | Y | 5.17 | 3.73 | 0.7 | 1.2738E7 |  |
 |
5.9947E6 | 1.987E7 | 1.2348E7 | 3.31 | 1 | 291 | 306 | |
| K.AELDDTPMR.G | N | Y | 3.71 | 2.98 | 4.9 | 1.0313E7 |  |
 |
4.7873E6 | 1.5611E7 | 1.4445E7 | 3.26 | 1 | 342 | 350 | |
| K.ANLSLLR.R | N | Y | 4.55 | 5.51 | 0.6 | 1.003E7 |  |
 |
3.1131E6 | 1.3517E7 | 1.3461E7 | 4.34 | 1 | 272 | 278 | |
| R.SPPPGMGLNQNR.G | N | Y | 4.85 | 4.75 | 0.7 | 9.4683E6 |  |
 |
4.0224E6 | 1.4031E7 | 1.386E7 | 3.49 | 1 | 33 | 44 | |
| K.ISDSEGFK.A | N | Y | 4.69 | 5.03 | 0.7 | 9.0693E6 |  |
 |
2.8967E6 | 1.4489E7 | 1.3445E7 | 5.00 | 1 | 264 | 271 | |
| total 11 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.GFAFVTFDDHDSVDK.I | Y | Y | 5.93 | 3.35 | 0.6 | 5.5413E7 |  |
 |
2.4059E7 | 8.1334E7 | 6.0845E7 | 3.38 | 2 | 147 | 161 | |
| R.SSGPYGGGGQYFAKPR.N | Y | Y | 6.40 | 6.18 | 0.7 | 2.6241E7 |  |
 |
1.2034E7 | 2.8548E7 | 4.5279E7 | 3.76 | 2 | 338 | 353 | |
| K.LFIGGLSFETTDESLR.S | Y | Y | 4.47 | 3.82 | 0.9 | 2.246E7 |  |
 |
9.1001E6 | 3.9455E7 | 1.8824E7 | 4.34 | 1 | 16 | 31 | |
| K.SESPKEPEQLR.K | N | Y | 5.27 | 0.86 | 2.1 | 1.0168E7 |  |
 |
1.2522E7 | 9.6696E6 | 9.4594E6 | 1.32 | 2 | 4 | 14 | |
| K.RGFAFVTFDDHDSVDK.I | N | Y | 5.79 | 3.51 | 0.5 | 4.3192E6 |  |
 |
2.2583E6 | 5.4884E6 | 5.2109E6 | 2.43 | 1 | 146 | 161 | |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LPSDVVTAVR.G | Y | Y | 5.46 | 4.00 | 0.8 | 1.4113E7 |  |
 |
6.3499E6 | 1.6868E7 | 1.9121E7 | 3.01 | 1 | 363 | 372 | |
| K.VLPMNTGVEAGETAC(+57.02)K.L | Y | Y | 6.95 | 4.82 | 0.7 | 9.1496E6 |  |
|
3.5963E6 | 1.0734E7 | 1.3119E7 | 3.65 | 1 | 136 | 151 | Carbamidomethylation |
| K.YGAHNYHPLPVALER.G | Y | Y | 5.62 | 7.39 | 0.6 | 9.1331E6 |  |
 |
3.4994E6 | 1.099E7 | 1.291E7 | 3.69 | 1 | 50 | 64 | |
| R.AFYNNVLGEYEEYITK.L | N | Y | 29.11 | 6.42 | 1.2 | 4.6904E6 |  |
 |
2.4688E6 | 7.5397E6 | 8.1252E6 | 3.29 | 1 | 114 | 129 | |
| R.HQVLFIADEIQTGLAR.T | N | Y | 5.57 | 3.96 | 0.6 | 1.5671E6 |  |
 |
8.6005E5 | 1.619E6 | 2.2222E6 | 2.58 | 1 | 256 | 271 | |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LVIPSELGYGER.G | Y | Y | 4.86 | 4.96 | 0.4 | 9.3624E6 |  |
 |
1.8126E7 | 4.9388E6 | 5.0222E6 | 3.67 | 1 | 124 | 135 | |
| K.GWDQGLLGMC(+57.02)EGEK.R | Y | Y | 5.99 | 5.35 | 0.7 | 1.652E6 |  |
 |
3.0448E6 | 7.8793E5 | 1.1232E6 | 3.86 | 1 | 108 | 121 | Carbamidomethylation |
| R.KGDVLHMHYTGK.L | Y | Y | 4.38 | 7.40 | 4.2 | 2.6646E5 |  |
|
6.1574E5 | 1.1457E5 | 9.7721E4 | 6.30 | 1 | 68 | 79 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LVIPSELGYGER.G | Y | Y | 4.86 | 4.96 | 0.4 | 9.3624E6 | |
|
1.8126E7 | 4.9388E6 | 5.0222E6 | 3.67 | 1 | 121 | 132 | |
| K.GWDQGLLGMC(+57.02)EGEK.R | Y | Y | 5.99 | 5.35 | 0.7 | 1.652E6 | |
|
3.0448E6 | 7.8793E5 | 1.1232E6 | 3.86 | 1 | 105 | 118 | Carbamidomethylation |
| R.KGDVLHMHYTGK.L | Y | Y | 4.38 | 7.40 | 4.2 | 2.6646E5 | |
|
6.1574E5 | 1.1457E5 | 9.7721E4 | 6.30 | 1 | 65 | 76 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VMVQPINLIFR.Y | Y | Y | 4.25 | 3.89 | 1.7 | 9.3994E6 | |
|
3.5238E6 | 1.6106E7 | 8.5683E6 | 4.57 | 1 | 13 | 23 | |
| K.VM(+15.99)VQPINLIFR.Y | N | Y | 3.65 | 5.45 | 4.8 | 5.6855E6 |  |
 |
8.6496E5 | 9.7093E6 | 6.4822E6 | 11.23 | 1 | 13 | 23 | Oxidation (M) |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VMVQPINLIFR.Y | Y | Y | 4.25 | 3.89 | 1.7 | 9.3994E6 | |
|
3.5238E6 | 1.6106E7 | 8.5683E6 | 4.57 | 1 | 13 | 23 | |
| K.VM(+15.99)VQPINLIFR.Y | N | Y | 3.65 | 5.45 | 4.8 | 5.6855E6 | |
|
8.6496E5 | 9.7093E6 | 6.4822E6 | 11.23 | 1 | 13 | 23 | Oxidation (M) |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VMVQPINLIFR.Y | Y | Y | 4.25 | 3.89 | 1.7 | 9.3994E6 | |
|
3.5238E6 | 1.6106E7 | 8.5683E6 | 4.57 | 1 | 13 | 23 | |
| K.VM(+15.99)VQPINLIFR.Y | N | Y | 3.65 | 5.45 | 4.8 | 5.6855E6 | |
|
8.6496E5 | 9.7093E6 | 6.4822E6 | 11.23 | 1 | 13 | 23 | Oxidation (M) |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.FVTAVATGGPDNQVHFEGYQVSNQC(+57.02)MALVR.D | Y | Y | 20.48 | 16.51 | 1.7 | 1.1294E6 |  |
 |
2.6289E6 | 3.3843E5 | 4.2093E5 | 7.77 | 1 | 367 | 396 | Carbamidomethylation |
| K.DTYFLSSEEC(+57.02)ITAGDFQNK.H | Y | Y | 14.94 | 8.87 | 1.0 | 1.8351E5 |  |
 |
3.7938E5 | 8.7016E4 | 8.4126E4 | 4.51 | 1 | 332 | 350 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.AGPGSEELTVTNAR.Y | Y | Y | 8.61 | 2.68 | 3.9 | 5.0478E5 | |
|
7.5544E5 | 2.5625E5 | 5.667E5 | 2.95 | 1 | 510 | 523 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.AGPGSEELTVTNAR.Y | Y | Y | 8.61 | 2.68 | 3.9 | 5.0478E5 | |
|
7.5544E5 | 2.5625E5 | 5.667E5 | 2.95 | 1 | 510 | 523 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NREPVQLETLSIR.G | Y | Y | 6.95 | 4.05 | 0.4 | 2.8767E7 |  |
 |
1.2881E7 | 3.5605E7 | 3.7815E7 | 2.94 | 2 | 49 | 61 | |
| K.LSHETVTIELK.N | Y | Y | 5.65 | 4.36 | 1.2 | 2.3319E7 |  |
|
9.8239E6 | 2.8646E7 | 3.1486E7 | 3.20 | 2 | 10 | 20 | |
| K.NGTQVHGTITGVDVSMNTHLK.A | Y | Y | 8.71 | 3.40 | 0.8 | 3.4464E6 |  |
 |
1.4881E6 | 4.2484E6 | 4.6026E6 | 3.09 | 1 | 21 | 41 | |
| R.EPVQLETLSIR.G | N | Y | 5.99 | 1.69 | 5.3 | 1.7863E6 |  |
 |
1.3638E6 | 2.3306E6 | 1.6644E6 | 1.71 | 1 | 51 | 61 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.FC(+57.02)NPGFPIGC(+57.02)YITDK.G | Y | Y | 6.09 | 12.96 | 0.6 | 2.6245E6 |  |
 |
5.384E6 | 1.1377E6 | 1.3517E6 | 4.73 | 1 | 173 | 187 | Carbamidomethylation |
| R.YNQMDSTEDAQEEFGWK.L | Y | Y | 17.13 | 11.67 | 4.2 | 7.7767E5 |  |
|
1.6348E6 | 3.69E5 | 3.2919E5 | 4.97 | 1 | 333 | 349 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.FAQPGSFEYEYAMR.W | Y | Y | 6.14 | 5.53 | 1.4 | 1.8785E7 |  |
 |
7.6003E6 | 2.4796E7 | 2.3959E7 | 3.26 | 1 | 262 | 275 | |
| K.VELDNMPLR.G | Y | Y | 4.76 | 2.46 | 1.0 | 1.8451E7 |  |
 |
1.1825E7 | 2.1647E7 | 2.1881E7 | 1.85 | 1 | 132 | 140 | |
| R.LFVGNLPPDITEEEMR.K | Y | Y | 3.47 | 8.04 | 6.4 | 1.7989E7 |  |
 |
1.5172E6 | 2.8213E7 | 2.4237E7 | 18.60 | 1 | 81 | 96 | |
| K.AGEVFIHK.D | N | Y | 4.23 | 3.49 | 0.6 | 1.4297E7 |  |
 |
6.9165E6 | 2.2401E7 | 1.9173E7 | 3.24 | 1 | 105 | 112 | |
| R.FAC(+57.02)HSASLTVR.N | N | Y | 3.83 | 1.92 | 7.4 | 6.2624E6 |  |
 |
1.1388E7 | 4.5169E6 | 4.0111E6 | 2.84 | 1 | 148 | 158 | Carbamidomethylation |
| R.MEELHNQEVQK.R | N | Y | 5.33 | 6.77 | 3.9 | 1.5042E6 |  |
 |
6.9999E5 | 2.6381E6 | 1.8342E6 | 3.77 | 1 | 331 | 341 | |
| R.RMEELHNQEVQK.R | N | Y | 15.50 | 1.98 | 4.6 | 6.2786E4 |  |
 |
8.7891E4 | 6.235E4 | 5.3706E4 | 1.64 | 1 | 330 | 341 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.EAAWAITNATSGGTPEQIR.Y | Y | Y | 6.45 | 13.69 | 1.3 | 1.2956E6 | |
|
2.0442E5 | 1.8448E6 | 1.8887E6 | 9.24 | 1 | 397 | 415 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.EAAWAITNATSGGTPEQIR.Y | Y | Y | 6.45 | 13.69 | 1.3 | 1.2956E6 | |
|
2.0442E5 | 1.8448E6 | 1.8887E6 | 9.24 | 1 | 401 | 419 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NAVTQEFGPVPDTAR.Y | Y | Y | 6.11 | 4.03 | 0.8 | 9.3408E6 |  |
 |
1.7192E7 | 5.0776E6 | 5.7528E6 | 3.39 | 1 | 634 | 648 | |
| K.SQFTITPGSEQIR.A | Y | Y | 5.46 | 5.68 | 0.4 | 8.65E6 |  |
 |
1.6965E7 | 4.2441E6 | 4.7411E6 | 4.00 | 1 | 412 | 424 | |
| R.VGLIGSC(+57.02)TNSSYEDMGR.S | Y | Y | 5.93 | 2.69 | 1.2 | 5.29E6 |  |
 |
8.9044E6 | 3.1987E6 | 3.767E6 | 2.78 | 1 | 379 | 395 | Carbamidomethylation |
| R.WVVIGDENYGEGSSR.E | N | Y | 7.64 | 4.38 | 0.3 | 4.7908E6 |  |
 |
9.0626E6 | 2.5083E6 | 2.8015E6 | 3.61 | 1 | 657 | 671 | |
| R.DGYAQILR.D | N | Y | 4.83 | 1.69 | 4.4 | 2.5084E6 |  |
 |
2.9492E6 | 1.6553E6 | 2.9207E6 | 1.78 | 1 | 430 | 437 | |
| K.GGTGAIVEYHGPGVDSISC(+57.02)TGMATIC(+57.02)NMGAEIGATTSVFPYNHR.M | N | Y | 8.61 | 2.50 | 1.5 | 2.0416E6 |  |
 |
4.9801E6 | 1.7484E6 | 2.3234E6 | 2.85 | 1 | 259 | 302 | Carbamidomethylation |
| K.DLEDLQILIK.V | N | Y | 4.63 | 2.72 | 0.5 | 1.9445E6 |  |
 |
3.1509E6 | 1.4793E6 | 1.2033E6 | 2.62 | 1 | 578 | 587 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NAVTQEFGPVPDTAR.Y | Y | Y | 6.11 | 4.03 | 0.8 | 9.3408E6 | |
|
1.7192E7 | 5.0776E6 | 5.7528E6 | 3.39 | 1 | 581 | 595 | |
| K.SQFTITPGSEQIR.A | Y | Y | 5.46 | 5.68 | 0.4 | 8.65E6 | |
|
1.6965E7 | 4.2441E6 | 4.7411E6 | 4.00 | 1 | 359 | 371 | |
| R.VGLIGSC(+57.02)TNSSYEDMGR.S | Y | Y | 5.93 | 2.69 | 1.2 | 5.29E6 | |
|
8.9044E6 | 3.1987E6 | 3.767E6 | 2.78 | 1 | 326 | 342 | Carbamidomethylation |
| R.WVVIGDENYGEGSSR.E | N | Y | 7.64 | 4.38 | 0.3 | 4.7908E6 | |
|
9.0626E6 | 2.5083E6 | 2.8015E6 | 3.61 | 1 | 604 | 618 | |
| R.DGYAQILR.D | N | Y | 4.83 | 1.69 | 4.4 | 2.5084E6 | |
|
2.9492E6 | 1.6553E6 | 2.9207E6 | 1.78 | 1 | 377 | 384 | |
| K.GGTGAIVEYHGPGVDSISC(+57.02)TGMATIC(+57.02)NMGAEIGATTSVFPYNHR.M | N | Y | 8.61 | 2.50 | 1.5 | 2.0416E6 | |
|
4.9801E6 | 1.7484E6 | 2.3234E6 | 2.85 | 1 | 206 | 249 | Carbamidomethylation |
| K.DLEDLQILIK.V | N | Y | 4.63 | 2.72 | 0.5 | 1.9445E6 | |
|
3.1509E6 | 1.4793E6 | 1.2033E6 | 2.62 | 1 | 525 | 534 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NAVTQEFGPVPDTAR.Y | Y | Y | 6.11 | 4.03 | 0.8 | 9.3408E6 | |
|
1.7192E7 | 5.0776E6 | 5.7528E6 | 3.39 | 1 | 631 | 645 | |
| K.SQFTITPGSEQIR.A | Y | Y | 5.46 | 5.68 | 0.4 | 8.65E6 | |
|
1.6965E7 | 4.2441E6 | 4.7411E6 | 4.00 | 1 | 409 | 421 | |
| R.VGLIGSC(+57.02)TNSSYEDMGR.S | Y | Y | 5.93 | 2.69 | 1.2 | 5.29E6 | |
|
8.9044E6 | 3.1987E6 | 3.767E6 | 2.78 | 1 | 376 | 392 | Carbamidomethylation |
| R.WVVIGDENYGEGSSR.E | N | Y | 7.64 | 4.38 | 0.3 | 4.7908E6 | |
|
9.0626E6 | 2.5083E6 | 2.8015E6 | 3.61 | 1 | 654 | 668 | |
| R.DGYAQILR.D | N | Y | 4.83 | 1.69 | 4.4 | 2.5084E6 | |
|
2.9492E6 | 1.6553E6 | 2.9207E6 | 1.78 | 1 | 427 | 434 | |
| K.GGTGAIVEYHGPGVDSISC(+57.02)TGMATIC(+57.02)NMGAEIGATTSVFPYNHR.M | N | Y | 8.61 | 2.50 | 1.5 | 2.0416E6 | |
|
4.9801E6 | 1.7484E6 | 2.3234E6 | 2.85 | 1 | 256 | 299 | Carbamidomethylation |
| K.DLEDLQILIK.V | N | Y | 4.63 | 2.72 | 0.5 | 1.9445E6 | |
|
3.1509E6 | 1.4793E6 | 1.2033E6 | 2.62 | 1 | 575 | 584 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LQAEAPHIVVGTPGR.V | Y | Y | 8.11 | 4.95 | 0.8 | 6.1967E6 | |
|
1.2332E7 | 3.2812E6 | 2.9767E6 | 4.14 | 2 | 148 | 162 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.GAQAAIVVYDITNQETFAR.A | Y | Y | 13.27 | 5.70 | 0.9 | 6.0026E5 | |
|
1.2536E6 | 2.5359E5 | 2.9355E5 | 4.94 | 1 | 91 | 109 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.GAQAAIVVYDITNQETFAR.A | Y | Y | 13.27 | 5.70 | 0.9 | 6.0026E5 | |
|
1.2536E6 | 2.5359E5 | 2.9355E5 | 4.94 | 1 | 92 | 110 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ADIVENQVMDNR.M | Y | Y | 5.47 | 34.02 | 0.5 | 3.6834E7 |  |
|
1.0879E8 | 1.3525E6 | 4.7899E5 | 64.00 | 1 | 97 | 108 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VELSTGMPR.R | Y | Y | 4.08 | 4.41 | 2.5 | 1.2598E7 |  |
 |
4.301E6 | 1.7717E7 | 1.5775E7 | 4.12 | 1 | 79 | 87 | |
| K.GHYAYDC(+57.02)HR.Y | Y | Y | 5.58 | 12.30 | 0.7 | 4.4911E4 |  |
 |
7.1398E3 | 7.112E4 | 7.7822E4 | 10.90 | 1 | 113 | 121 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VELSTGMPR.R | Y | Y | 4.08 | 4.41 | 2.5 | 1.2598E7 | |
|
4.301E6 | 1.7717E7 | 1.5775E7 | 4.12 | 1 | 79 | 87 | |
| K.GHYAYDC(+57.02)HR.Y | Y | Y | 5.58 | 12.30 | 0.7 | 4.4911E4 | |
|
7.1398E3 | 7.112E4 | 7.7822E4 | 10.90 | 1 | 113 | 121 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VELSTGMPR.R | Y | Y | 4.08 | 4.41 | 2.5 | 1.2598E7 | |
|
4.301E6 | 1.7717E7 | 1.5775E7 | 4.12 | 1 | 79 | 87 | |
| K.GHYAYDC(+57.02)HR.Y | Y | Y | 5.58 | 12.30 | 0.7 | 4.4911E4 | |
|
7.1398E3 | 7.112E4 | 7.7822E4 | 10.90 | 1 | 113 | 121 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VELSTGMPR.R | Y | Y | 4.08 | 4.41 | 2.5 | 1.2598E7 | |
|
4.301E6 | 1.7717E7 | 1.5775E7 | 4.12 | 1 | 79 | 87 | |
| K.GHYAYDC(+57.02)HR.Y | Y | Y | 5.58 | 12.30 | 0.7 | 4.4911E4 | |
|
7.1398E3 | 7.112E4 | 7.7822E4 | 10.90 | 1 | 113 | 121 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.GFGFVDFNSEEDAK.A | Y | Y | 6.00 | 2.76 | 0.3 | 5.6171E7 |  |
|
2.9549E7 | 6.9705E7 | 6.9258E7 | 2.36 | 1 | 579 | 592 | |
| K.GLSEDTTEETLK.E | Y | Y | 5.79 | 4.50 | 0.4 | 4.5371E7 |  |
 |
2.2042E7 | 7.2239E7 | 5.9893E7 | 3.28 | 1 | 546 | 557 | |
| K.ALELTGLK.V | Y | Y | 5.38 | 8.59 | 1.0 | 4.4648E7 |  |
 |
1.4279E7 | 5.6042E7 | 6.3623E7 | 4.46 | 1 | 332 | 339 | |
| R.LELQGPR.G | N | Y | 5.48 | 6.37 | 0.7 | 4.1201E7 |  |
 |
1.7795E7 | 5.8258E7 | 6.2116E7 | 3.49 | 1 | 523 | 529 | |
| K.FGYVDFESAEDLEK.A | N | Y | 6.09 | 2.96 | 0.6 | 4.0965E7 |  |
 |
2.5037E7 | 5.0869E7 | 4.6989E7 | 2.03 | 1 | 318 | 331 | |
| K.GIAYIEFK.S | N | Y | 5.47 | 3.58 | 0.6 | 3.5622E7 |  |
 |
1.7575E7 | 4.4545E7 | 4.4746E7 | 2.55 | 1 | 399 | 406 | |
| R.KFGYVDFESAEDLEK.A | N | Y | 6.26 | 10.03 | 1.2 | 2.8548E7 |  |
|
1.0703E7 | 3.7739E7 | 3.7201E7 | 3.53 | 2 | 317 | 331 | |
| K.EAMEDGEIDGNK.V | N | Y | 4.41 | 5.25 | 0.8 | 1.3664E7 |  |
 |
3.9345E6 | 2.1809E7 | 2.07E7 | 5.54 | 1 | 596 | 607 | |
| K.VTLDWAKPK.G | N | Y | 5.67 | 3.99 | 0.8 | 1.481E7 |  |
 |
7.9994E6 | 1.6773E7 | 1.9659E7 | 2.46 | 2 | 608 | 616 | |
| K.GYAFIEFASFEDAK.E | N | Y | 4.48 | 2.50 | 0.9 | 2.5621E6 |  |
 |
1.4238E6 | 3.7206E6 | 2.5418E6 | 2.61 | 1 | 492 | 505 | |
| K.EAMEDGEIDGNKVTLDWAKPK.G | N | Y | 14.87 | 8.35 | 2.3 | 7.2047E5 |  |
 |
4.6061E5 | 2.9203E5 | 1.4088E6 | 4.82 | 1 | 596 | 616 | |
| total 11 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.GFGFVDFNSEEDAK.A | Y | Y | 6.00 | 2.76 | 0.3 | 5.6171E7 | |
|
2.9549E7 | 6.9705E7 | 6.9258E7 | 2.36 | 1 | 615 | 628 | |
| K.GLSEDTTEETLK.E | Y | Y | 5.79 | 4.50 | 0.4 | 4.5371E7 | |
|
2.2042E7 | 7.2239E7 | 5.9893E7 | 3.28 | 1 | 582 | 593 | |
| K.ALELTGLK.V | Y | Y | 5.38 | 8.59 | 1.0 | 4.4648E7 | |
|
1.4279E7 | 5.6042E7 | 6.3623E7 | 4.46 | 1 | 368 | 375 | |
| R.LELQGPR.G | N | Y | 5.48 | 6.37 | 0.7 | 4.1201E7 | |
|
1.7795E7 | 5.8258E7 | 6.2116E7 | 3.49 | 1 | 559 | 565 | |
| K.FGYVDFESAEDLEK.A | N | Y | 6.09 | 2.96 | 0.6 | 4.0965E7 | |
|
2.5037E7 | 5.0869E7 | 4.6989E7 | 2.03 | 1 | 354 | 367 | |
| K.GIAYIEFK.S | N | Y | 5.47 | 3.58 | 0.6 | 3.5622E7 | |
|
1.7575E7 | 4.4545E7 | 4.4746E7 | 2.55 | 1 | 435 | 442 | |
| R.KFGYVDFESAEDLEK.A | N | Y | 6.26 | 10.03 | 1.2 | 2.8548E7 | |
|
1.0703E7 | 3.7739E7 | 3.7201E7 | 3.53 | 2 | 353 | 367 | |
| K.EAMEDGEIDGNK.V | N | Y | 4.41 | 5.25 | 0.8 | 1.3664E7 | |
|
3.9345E6 | 2.1809E7 | 2.07E7 | 5.54 | 1 | 632 | 643 | |
| K.VTLDWAKPK.G | N | Y | 5.67 | 3.99 | 0.8 | 1.481E7 | |
|
7.9994E6 | 1.6773E7 | 1.9659E7 | 2.46 | 2 | 644 | 652 | |
| K.GYAFIEFASFEDAK.E | N | Y | 4.48 | 2.50 | 0.9 | 2.5621E6 | |
|
1.4238E6 | 3.7206E6 | 2.5418E6 | 2.61 | 1 | 528 | 541 | |
| K.EAMEDGEIDGNKVTLDWAKPK.G | N | Y | 14.87 | 8.35 | 2.3 | 7.2047E5 | |
|
4.6061E5 | 2.9203E5 | 1.4088E6 | 4.82 | 1 | 632 | 652 | |
| total 11 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NVPYVFVR.S | Y | Y | 4.37 | 4.57 | 0.4 | 1.0408E7 |  |
 |
3.4929E6 | 1.6037E7 | 1.1694E7 | 4.59 | 1 | 77 | 84 | |
| K.LLDLVQQSC(+57.02)NYK.Q | Y | Y | 5.25 | 4.80 | 0.4 | 9.9352E6 |  |
 |
3.5792E6 | 1.4367E7 | 1.1859E7 | 4.01 | 1 | 22 | 33 | Carbamidomethylation |
| K.QQIQSIQQSIER.L | Y | Y | 6.17 | 4.67 | 0.7 | 9.6365E6 |  |
 |
5.5051E6 | 1.3359E7 | 1.0045E7 | 2.43 | 1 | 114 | 125 | |
| K.AYPLADAHLTK.K | N | Y | 5.81 | 7.10 | 0.7 | 9.3076E6 |  |
 |
4.7467E6 | 1.2478E7 | 1.0698E7 | 2.63 | 2 | 10 | 20 | |
| K.KLLDLVQQSC(+57.02)NYK.Q | N | Y | 8.04 | 5.02 | 0.5 | 3.0588E5 |  |
 |
9.9961E4 | 4.0734E5 | 4.1034E5 | 4.11 | 1 | 21 | 33 | Carbamidomethylation |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LPEYTLSQEGGPAHK.R | Y | Y | 11.67 | 5.28 | 1.5 | 2.3685E6 |  |
 |
4.445E6 | 1.1756E6 | 1.4849E6 | 3.78 | 1 | 142 | 156 | |
| R.VTVGDITC(+57.02)TGEGTSK.K | Y | Y | 6.14 | 4.65 | 2.5 | 1.5853E6 |  |
 |
2.9119E6 | 9.9059E5 | 1.101E6 | 2.94 | 1 | 70 | 84 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.EVGEAFTILSDPK.K | Y | Y | 4.41 | 5.50 | 0.8 | 2.5475E6 |  |
 |
6.6515E5 | 3.4627E6 | 3.5147E6 | 5.28 | 1 | 515 | 527 | |
| R.GLC(+57.02)LYYEDC(+57.02)IEK.A | Y | Y | 7.37 | 5.78 | 1.2 | 2.2112E6 |  |
 |
6.6348E5 | 2.6659E6 | 3.3043E6 | 4.98 | 1 | 302 | 313 | Carbamidomethylation |
| K.LAYELYTEALGIDPNNIK.T | Y | Y | 5.96 | 5.52 | 0.7 | 1.5722E6 |  |
 |
6.7902E5 | 1.9888E6 | 2.0488E6 | 3.02 | 1 | 359 | 376 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.EVGEAFTILSDPK.K | Y | Y | 4.41 | 5.50 | 0.8 | 2.5475E6 | |
|
6.6515E5 | 3.4627E6 | 3.5147E6 | 5.28 | 1 | 414 | 426 | |
| R.GLC(+57.02)LYYEDC(+57.02)IEK.A | Y | Y | 7.37 | 5.78 | 1.2 | 2.2112E6 | |
|
6.6348E5 | 2.6659E6 | 3.3043E6 | 4.98 | 1 | 201 | 212 | Carbamidomethylation |
| K.LAYELYTEALGIDPNNIK.T | Y | Y | 5.96 | 5.52 | 0.7 | 1.5722E6 | |
|
6.7902E5 | 1.9888E6 | 2.0488E6 | 3.02 | 1 | 258 | 275 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LTFDSSFSPNTGK.K | Y | Y | 6.02 | 2.93 | 0.5 | 2.314E7 |  |
 |
3.5085E7 | 1.9278E7 | 1.5057E7 | 2.33 | 1 | 97 | 109 | |
| M.A(+42.01)VPPTYADLGK.S | Y | Y | 5.44 | 7.76 | 1.6 | 2.252E7 |  |
 |
4.8835E7 | 1.0028E7 | 8.6986E6 | 5.61 | 1 | 2 | 12 | Acetylation (N-term) |
| R.WTEYGLTFTEK.W | N | Y | 5.18 | 2.23 | 0.4 | 1.3956E7 |  |
 |
1.9662E7 | 1.1916E7 | 1.0291E7 | 1.91 | 1 | 64 | 74 | |
| K.KLETAVNLAWTAGNSNTR.F | N | Y | 8.96 | 1.68 | 1.6 | 1.3784E7 |  |
 |
1.8007E7 | 1.2905E7 | 1.044E7 | 1.72 | 2 | 201 | 218 | |
| K.LETAVNLAWTAGNSNTR.F | N | Y | 5.04 | 14.31 | 3.3 | 2.1948E6 |  |
 |
5.7512E6 | 5.009E5 | 3.3225E5 | 17.31 | 1 | 202 | 218 | |
| K.WNTDNTLGTEITVEDQLAR.G | Y | Y | 5.53 | 3.36 | 0.9 | 1.6864E7 |  |
 |
2.6073E7 | 1.3683E7 | 1.123E7 | 2.32 | 2 | 75 | 93 | |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.HHC(+57.02)PNTPIILVGTK.L | Y | Y | 5.16 | 4.95 | 1.5 | 6.0744E6 |  |
 |
1.1462E7 | 3.5959E6 | 4.0641E6 | 3.19 | 1 | 103 | 116 | Carbamidomethylation |
| K.LTPITYPQGLAMAK.E | Y | Y | 6.64 | 4.53 | 2.5 | 2.5881E6 |  |
 |
4.721E6 | 1.479E6 | 1.5643E6 | 3.19 | 1 | 134 | 147 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.HHC(+57.02)PNTPIILVGTK.L | Y | Y | 5.16 | 4.95 | 1.5 | 6.0744E6 | |
|
1.1462E7 | 3.5959E6 | 4.0641E6 | 3.19 | 1 | 122 | 135 | Carbamidomethylation |
| K.LTPITYPQGLAMAK.E | Y | Y | 6.64 | 4.53 | 2.5 | 2.5881E6 | |
|
4.721E6 | 1.479E6 | 1.5643E6 | 3.19 | 1 | 153 | 166 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.GQFHEFQESTIGAAFLTQTVC(+57.02)LDDTTVK.F | Y | Y | 7.57 | 6.08 | 1.6 | 1.2444E6 |  |
 |
2.5438E6 | 7.3442E5 | 4.5491E5 | 5.59 | 1 | 43 | 70 | Carbamidomethylation |
| R.AVDFQEAQSYADDNSLLFMETSAK.T | Y | Y | 8.49 | 4.88 | 2.3 | 9.2849E5 |  |
 |
1.8022E6 | 4.9804E5 | 5.2212E5 | 3.62 | 2 | 142 | 165 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.GQFHEFQESTIGAAFLTQTVC(+57.02)LDDTTVK.F | Y | Y | 7.57 | 6.08 | 1.6 | 1.2444E6 | |
|
2.5438E6 | 7.3442E5 | 4.5491E5 | 5.59 | 1 | 43 | 70 | Carbamidomethylation |
| R.AVDFQEAQSYADDNSLLFMETSAK.T | Y | Y | 8.49 | 4.88 | 2.3 | 9.2849E5 | |
|
1.8022E6 | 4.9804E5 | 5.2212E5 | 3.62 | 2 | 142 | 165 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ESTESSNTTIEDEDVK.A | Y | Y | 4.91 | 11.06 | 2.0 | 3.8766E5 | |
|
1.0305E6 | 6.7953E4 | 8.1476E4 | 15.17 | 1 | 363 | 378 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ESTESSNTTIEDEDVK.A | Y | Y | 4.91 | 11.06 | 2.0 | 3.8766E5 | |
|
1.0305E6 | 6.7953E4 | 8.1476E4 | 15.17 | 1 | 363 | 378 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.TGTSC(+57.02)ALDC(+57.02)GAGIGR.I | Y | Y | 5.08 | 6.55 | 1.0 | 1.9243E6 |  |
 |
6.0506E5 | 3.2599E6 | 2.7229E6 | 5.39 | 1 | 60 | 74 | Carbamidomethylation |
| R.LLLPLFR.V | Y | Y | 3.66 | 13.70 | 1.1 | 1.7272E6 |  |
 |
2.5668E4 | 1.6779E6 | 3.4973E6 | 64.00 | 1 | 79 | 85 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.GENLVSMTVEGPPPK.D | Y | Y | 5.79 | 4.41 | 0.7 | 1.6085E7 |  |
 |
7.4267E6 | 1.9363E7 | 2.1465E7 | 2.89 | 1 | 74 | 88 | |
| R.IFIGTFK.A | Y | Y | 5.68 | 7.52 | 0.6 | 1.0216E7 |  |
 |
2.921E6 | 1.3224E7 | 1.4502E7 | 4.96 | 1 | 26 | 32 | |
| K.HMNLILC(+57.02)DC(+57.02)DEFRK.I | Y | Y | 4.40 | 2.97 | 3.5 | 7.842E6 |  |
 |
4.21E6 | 6.6745E6 | 1.2641E7 | 3.00 | 1 | 37 | 50 | Carbamidomethylation |
| K.HMNLILC(+57.02)DC(+57.02)DEFR.K | N | Y | 5.47 | 6.03 | 0.6 | 1.9659E6 |  |
 |
7.3733E5 | 2.9887E6 | 2.1717E6 | 4.05 | 1 | 37 | 49 | Carbamidomethylation |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.GENLVSMTVEGPPPK.D | Y | Y | 5.79 | 4.41 | 0.7 | 1.6085E7 | |
|
7.4267E6 | 1.9363E7 | 2.1465E7 | 2.89 | 1 | 74 | 88 | |
| R.IFIGTFK.A | Y | Y | 5.68 | 7.52 | 0.6 | 1.0216E7 | |
|
2.921E6 | 1.3224E7 | 1.4502E7 | 4.96 | 1 | 26 | 32 | |
| K.HMNLILC(+57.02)DC(+57.02)DEFRK.I | Y | Y | 4.40 | 2.97 | 3.5 | 7.842E6 | |
|
4.21E6 | 6.6745E6 | 1.2641E7 | 3.00 | 1 | 37 | 50 | Carbamidomethylation |
| K.HMNLILC(+57.02)DC(+57.02)DEFR.K | N | Y | 5.47 | 6.03 | 0.6 | 1.9659E6 | |
|
7.3733E5 | 2.9887E6 | 2.1717E6 | 4.05 | 1 | 37 | 49 | Carbamidomethylation |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.GENLVSMTVEGPPPK.D | Y | Y | 5.79 | 4.41 | 0.7 | 1.6085E7 | |
|
7.4267E6 | 1.9363E7 | 2.1465E7 | 2.89 | 1 | 74 | 88 | |
| R.IFIGTFK.A | Y | Y | 5.68 | 7.52 | 0.6 | 1.0216E7 | |
|
2.921E6 | 1.3224E7 | 1.4502E7 | 4.96 | 1 | 26 | 32 | |
| K.HMNLILC(+57.02)DC(+57.02)DEFRK.I | Y | Y | 4.40 | 2.97 | 3.5 | 7.842E6 | |
|
4.21E6 | 6.6745E6 | 1.2641E7 | 3.00 | 1 | 37 | 50 | Carbamidomethylation |
| K.HMNLILC(+57.02)DC(+57.02)DEFR.K | N | Y | 5.47 | 6.03 | 0.6 | 1.9659E6 | |
|
7.3733E5 | 2.9887E6 | 2.1717E6 | 4.05 | 1 | 37 | 49 | Carbamidomethylation |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.TIAQDYGVLK.A | Y | Y | 5.31 | 4.77 | 0.8 | 1.0363E8 |  |
 |
4.1614E7 | 1.2183E8 | 1.4744E8 | 3.54 | 1 | 111 | 120 | |
| R.LVQAFQFTDK.H | Y | Y | 5.50 | 3.03 | 0.4 | 8.9822E7 |  |
 |
4.8674E7 | 9.3631E7 | 1.2716E8 | 2.61 | 1 | 159 | 168 | |
| K.ATAVMPDGQFK.D | Y | Y | 6.07 | 4.57 | 0.9 | 8.0132E7 |  |
 |
4.4043E7 | 9.3347E7 | 1.03E8 | 2.34 | 1 | 17 | 27 | |
| K.ADEGISFR.G | N | Y | 5.32 | 4.88 | 0.5 | 5.7714E7 |  |
 |
2.887E7 | 6.9952E7 | 9.1807E7 | 3.18 | 1 | 121 | 128 | |
| K.DISLSDYK.G | N | Y | 4.75 | 14.45 | 3.0 | 4.1239E7 |  |
 |
5.8987E6 | 5.4061E7 | 6.3758E7 | 10.81 | 1 | 28 | 35 | |
| K.KQGGLGPMNIPLVSDPK.R | N | Y | 7.91 | 3.50 | 0.7 | 2.2052E7 |  |
 |
1.1092E7 | 2.3864E7 | 3.12E7 | 2.81 | 2 | 93 | 109 | |
| K.QGGLGPMNIPLVSDPK.R | N | Y | 6.19 | 7.88 | 0.4 | 1.5386E7 |  |
 |
6.6943E6 | 1.7821E7 | 2.1644E7 | 3.23 | 1 | 94 | 109 | |
| R.QITINDLPVGR.S | N | Y | 4.20 | 5.38 | 0.3 | 1.249E7 |  |
 |
2.8348E7 | 4.1878E6 | 4.9334E6 | 6.77 | 1 | 141 | 151 | |
| total 8 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.TIAQDYGVLK.A | Y | Y | 5.31 | 4.77 | 0.8 | 1.0363E8 | |
|
4.1614E7 | 1.2183E8 | 1.4744E8 | 3.54 | 1 | 111 | 120 | |
| R.LVQAFQFTDK.H | Y | Y | 5.50 | 3.03 | 0.4 | 8.9822E7 | |
|
4.8674E7 | 9.3631E7 | 1.2716E8 | 2.61 | 1 | 159 | 168 | |
| K.ATAVMPDGQFK.D | Y | Y | 6.07 | 4.57 | 0.9 | 8.0132E7 | |
|
4.4043E7 | 9.3347E7 | 1.03E8 | 2.34 | 1 | 17 | 27 | |
| K.ADEGISFR.G | N | Y | 5.32 | 4.88 | 0.5 | 5.7714E7 | |
|
2.887E7 | 6.9952E7 | 9.1807E7 | 3.18 | 1 | 121 | 128 | |
| K.DISLSDYK.G | N | Y | 4.75 | 14.45 | 3.0 | 4.1239E7 | |
|
5.8987E6 | 5.4061E7 | 6.3758E7 | 10.81 | 1 | 28 | 35 | |
| K.KQGGLGPMNIPLVSDPK.R | N | Y | 7.91 | 3.50 | 0.7 | 2.2052E7 | |
|
1.1092E7 | 2.3864E7 | 3.12E7 | 2.81 | 2 | 93 | 109 | |
| K.QGGLGPMNIPLVSDPK.R | N | Y | 6.19 | 7.88 | 0.4 | 1.5386E7 | |
|
6.6943E6 | 1.7821E7 | 2.1644E7 | 3.23 | 1 | 94 | 109 | |
| R.QITINDLPVGR.S | N | Y | 4.20 | 5.38 | 0.3 | 1.249E7 | |
|
2.8348E7 | 4.1878E6 | 4.9334E6 | 6.77 | 1 | 141 | 151 | |
| total 8 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LVQAFQYTDK.H | Y | Y | 5.78 | 3.91 | 0.7 | 8.7788E6 |  |
 |
4.0692E6 | 1.0016E7 | 1.2251E7 | 3.01 | 1 | 233 | 242 | |
| K.HGEVC(+57.02)PAGWKPGSETIIPDPAGK.L | Y | Y | 8.02 | 3.02 | 0.5 | 8.128E6 |  |
 |
4.0028E6 | 1.0804E7 | 9.5776E6 | 2.70 | 2 | 243 | 265 | Carbamidomethylation |
| K.DYGVYLEDSGHTLR.G | Y | Y | 6.19 | 12.92 | 0.9 | 7.0088E6 |  |
 |
2.16E6 | 8.499E6 | 1.0367E7 | 4.80 | 2 | 189 | 202 | |
| K.SINTEVVAC(+57.02)SVDSQFTHLAWINTPR.R | N | Y | 4.98 | 4.65 | 2.2 | 4.4344E6 |  |
 |
2.5988E6 | 6.1076E6 | 4.5968E6 | 2.35 | 1 | 142 | 166 | Carbamidomethylation |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LVQAFQYTDK.H | Y | Y | 5.78 | 3.91 | 0.7 | 8.7788E6 | |
|
4.0692E6 | 1.0016E7 | 1.2251E7 | 3.01 | 1 | 213 | 222 | |
| K.HGEVC(+57.02)PAGWKPGSETIIPDPAGK.L | Y | Y | 8.02 | 3.02 | 0.5 | 8.128E6 | |
|
4.0028E6 | 1.0804E7 | 9.5776E6 | 2.70 | 2 | 223 | 245 | Carbamidomethylation |
| K.DYGVYLEDSGHTLR.G | Y | Y | 6.19 | 12.92 | 0.9 | 7.0088E6 | |
|
2.16E6 | 8.499E6 | 1.0367E7 | 4.80 | 2 | 169 | 182 | |
| K.SINTEVVAC(+57.02)SVDSQFTHLAWINTPR.R | N | Y | 4.98 | 4.65 | 2.2 | 4.4344E6 | |
|
2.5988E6 | 6.1076E6 | 4.5968E6 | 2.35 | 1 | 122 | 146 | Carbamidomethylation |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SLLVTELGSSR.K | Y | Y | 4.84 | 6.14 | 1.3 | 4.289E6 | |
|
8.4218E6 | 1.9354E6 | 2.5098E6 | 4.35 | 1 | 210 | 220 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.FPEDLENDIR.T | Y | Y | 4.34 | 3.30 | 4.1 | 7.0712E6 |  |
 |
2.8787E6 | 9.0403E6 | 9.2947E6 | 3.23 | 1 | 40 | 49 | |
| K.LC(+57.02)QDLPC(+57.02)FSR.E | Y | Y | 4.84 | 7.34 | 0.7 | 4.9241E6 |  |
 |
1.2212E6 | 6.1681E6 | 7.3829E6 | 6.05 | 1 | 293 | 302 | Carbamidomethylation |
| K.VDENFDC(+57.02)VEADDVEGK.I | Y | Y | 7.05 | 3.39 | 0.8 | 4.0474E6 |  |
 |
1.697E6 | 5.136E6 | 5.3091E6 | 3.13 | 1 | 95 | 110 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.FPEDLENDIR.T | Y | Y | 4.34 | 3.30 | 4.1 | 7.0712E6 | |
|
2.8787E6 | 9.0403E6 | 9.2947E6 | 3.23 | 1 | 57 | 66 | |
| K.LC(+57.02)QDLPC(+57.02)FSR.E | Y | Y | 4.84 | 7.34 | 0.7 | 4.9241E6 | |
|
1.2212E6 | 6.1681E6 | 7.3829E6 | 6.05 | 1 | 310 | 319 | Carbamidomethylation |
| K.VDENFDC(+57.02)VEADDVEGK.I | Y | Y | 7.05 | 3.39 | 0.8 | 4.0474E6 | |
|
1.697E6 | 5.136E6 | 5.3091E6 | 3.13 | 1 | 112 | 127 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.FPEDLENDIR.T | Y | Y | 4.34 | 3.30 | 4.1 | 7.0712E6 | |
|
2.8787E6 | 9.0403E6 | 9.2947E6 | 3.23 | 1 | 40 | 49 | |
| K.LC(+57.02)QDLPC(+57.02)FSR.E | Y | Y | 4.84 | 7.34 | 0.7 | 4.9241E6 | |
|
1.2212E6 | 6.1681E6 | 7.3829E6 | 6.05 | 1 | 293 | 302 | Carbamidomethylation |
| K.VDENFDC(+57.02)VEADDVEGK.I | Y | Y | 7.05 | 3.39 | 0.8 | 4.0474E6 | |
|
1.697E6 | 5.136E6 | 5.3091E6 | 3.13 | 1 | 95 | 110 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LYTLVLTDPDAPSR.K | Y | Y | 5.71 | 4.86 | 0.6 | 6.1737E7 |  |
 |
1.1166E8 | 3.3165E7 | 4.039E7 | 3.37 | 1 | 63 | 76 | |
| R.VDYGGVTVDELGK.V | Y | Y | 4.21 | 18.11 | 5.7 | 3.1267E7 |  |
 |
9.0216E7 | 1.5307E6 | 2.0552E6 | 58.94 | 1 | 27 | 39 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LYTLVLTDPDAPSR.K | Y | Y | 5.71 | 4.86 | 0.6 | 6.1737E7 | |
|
1.1166E8 | 3.3165E7 | 4.039E7 | 3.37 | 1 | 63 | 76 | |
| R.VDYGGVTVDELGK.V | Y | Y | 4.21 | 18.11 | 5.7 | 3.1267E7 | |
|
9.0216E7 | 1.5307E6 | 2.0552E6 | 58.94 | 1 | 27 | 39 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NIEEHASSDVER.M | Y | Y | 6.35 | 3.06 | 4.3 | 1.2981E5 | |
|
2.8549E5 | 1.0036E5 | 1.0752E5 | 2.84 | 1 | 105 | 116 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.FWEVISDEHGIDPSGNYVGDSDLQLER.I | Y | Y | 3.36 | 11.05 | 2.3 | 5.4065E6 |  |
|
1.5854E7 | 2.0546E5 | 1.5975E5 | 64.00 | 1 | 20 | 46 | |
| K.EVDEQMLAIQSK.N | Y | Y | 5.28 | 2.26 | 0.9 | 4.7914E6 |  |
 |
6.4366E6 | 3.8469E6 | 4.0908E6 | 1.67 | 1 | 325 | 336 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NDFTEEEEAQVR.K | Y | Y | 5.21 | 3.70 | 0.8 | 1.2002E7 |  |
 |
1.9171E7 | 8.4408E6 | 1.0504E7 | 2.27 | 1 | 143 | 154 | |
| R.TDDIPVWDQEFLK.V | Y | Y | 5.16 | 5.46 | 1.1 | 8.4388E6 |  |
 |
1.5114E7 | 5.4878E6 | 4.7142E6 | 3.21 | 1 | 82 | 94 | |
| K.LQSSDGEIFEVDVEIAK.Q | Y | Y | 4.34 | 4.11 | 2.0 | 4.1464E6 |  |
 |
8.0543E6 | 2.1998E6 | 4.38E6 | 3.66 | 1 | 6 | 22 | |
| K.RTDDIPVWDQEFLK.V | N | Y | 5.79 | 4.08 | 0.7 | 3.4781E6 |  |
|
5.817E6 | 2.0558E6 | 2.5613E6 | 2.83 | 1 | 81 | 94 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NDFTEEEEAQVR.K | Y | Y | 5.21 | 3.70 | 0.8 | 1.2002E7 | |
|
1.9171E7 | 8.4408E6 | 1.0504E7 | 2.27 | 1 | 145 | 156 | |
| R.TDDIPVWDQEFLK.V | Y | Y | 5.16 | 5.46 | 1.1 | 8.4388E6 | |
|
1.5114E7 | 5.4878E6 | 4.7142E6 | 3.21 | 1 | 84 | 96 | |
| K.LQSSDGEIFEVDVEIAK.Q | Y | Y | 4.34 | 4.11 | 2.0 | 4.1464E6 | |
|
8.0543E6 | 2.1998E6 | 4.38E6 | 3.66 | 1 | 8 | 24 | |
| K.RTDDIPVWDQEFLK.V | N | Y | 5.79 | 4.08 | 0.7 | 3.4781E6 | |
|
5.817E6 | 2.0558E6 | 2.5613E6 | 2.83 | 1 | 83 | 96 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NLVPGESVYGEK.R | Y | Y | 4.66 | 4.70 | 0.9 | 1.5036E7 |  |
|
6.6029E6 | 1.8552E7 | 1.9954E7 | 3.02 | 1 | 116 | 127 | |
| R.TNIIPVIEDAR.H | Y | Y | 4.34 | 3.43 | 5.4 | 1.4599E7 |  |
 |
6.5365E6 | 2.1027E7 | 1.6234E7 | 3.22 | 1 | 214 | 224 | |
| R.DHAVVVGVYRPPPK.A | N | Y | 5.94 | 5.56 | 0.4 | 1.1188E7 |  |
 |
4.068E6 | 2.2482E7 | 1.2635E7 | 5.53 | 1 | 311 | 324 | |
| R.VSISEGDDKIEYR.A | N | Y | 15.10 | 8.29 | 0.8 | 1.1113E7 |  |
 |
4.2358E6 | 1.5579E7 | 1.4094E7 | 3.68 | 2 | 129 | 141 | |
| K.MQQENMKPQEQLTLEPYER.D | N | Y | 8.27 | 3.03 | 0.7 | 2.3394E6 |  |
 |
1.0591E6 | 3.0277E6 | 2.9315E6 | 2.86 | 1 | 292 | 310 | |
| K.LAAAILGGVDQIHIKPGAK.V | Y | Y | 6.76 | 4.67 | 0.7 | 1.17E7 |  |
 |
4.9917E6 | 1.8182E7 | 1.1925E7 | 3.64 | 2 | 150 | 168 | |
| K.RVSISEGDDKIEYR.A | N | Y | 10.10 | 6.11 | 0.8 | 7.905E5 |  |
 |
2.2886E5 | 1.3043E6 | 1.1644E6 | 5.70 | 1 | 128 | 141 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NLVPGESVYGEK.R | Y | Y | 4.66 | 4.70 | 0.9 | 1.5036E7 | |
|
6.6029E6 | 1.8552E7 | 1.9954E7 | 3.02 | 1 | 119 | 130 | |
| R.TNIIPVIEDAR.H | Y | Y | 4.34 | 3.43 | 5.4 | 1.4599E7 | |
|
6.5365E6 | 2.1027E7 | 1.6234E7 | 3.22 | 1 | 217 | 227 | |
| R.DHAVVVGVYRPPPK.A | N | Y | 5.94 | 5.56 | 0.4 | 1.1188E7 | |
|
4.068E6 | 2.2482E7 | 1.2635E7 | 5.53 | 1 | 314 | 327 | |
| R.VSISEGDDKIEYR.A | N | Y | 15.10 | 8.29 | 0.8 | 1.1113E7 | |
|
4.2358E6 | 1.5579E7 | 1.4094E7 | 3.68 | 2 | 132 | 144 | |
| K.MQQENMKPQEQLTLEPYER.D | N | Y | 8.27 | 3.03 | 0.7 | 2.3394E6 | |
|
1.0591E6 | 3.0277E6 | 2.9315E6 | 2.86 | 1 | 295 | 313 | |
| K.LAAAILGGVDQIHIKPGAK.V | Y | Y | 6.76 | 4.67 | 0.7 | 1.17E7 | |
|
4.9917E6 | 1.8182E7 | 1.1925E7 | 3.64 | 2 | 153 | 171 | |
| K.RVSISEGDDKIEYR.A | N | Y | 10.10 | 6.11 | 0.8 | 7.905E5 | |
|
2.2886E5 | 1.3043E6 | 1.1644E6 | 5.70 | 1 | 131 | 144 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.QSIAIDDC(+57.02)TFHQC(+57.02)VR.L | Y | Y | 7.08 | 6.15 | 1.0 | 3.3236E6 |  |
 |
6.8177E6 | 1.4017E6 | 1.7514E6 | 4.86 | 1 | 239 | 253 | Carbamidomethylation |
| K.WARPPISMNFEVPFAPSGLK.V | Y | Y | 4.03 | 6.56 | 2.2 | 2.8277E6 |  |
 |
6.0441E6 | 9.0584E5 | 1.5331E6 | 6.67 | 1 | 381 | 400 | |
| K.ESQISAEIELLPTNDK.K | Y | Y | 5.37 | 0.75 | 1.5 | 1.5356E6 |  |
 |
1.7595E6 | 1.4132E6 | 1.4342E6 | 1.25 | 1 | 363 | 378 | |
| R.IPTPLNTSGVQVIC(+57.02)MK.G | N | Y | 7.38 | 2.44 | 0.8 | 1.3127E6 |  |
 |
2.0034E6 | 8.0914E5 | 1.1257E6 | 2.48 | 1 | 324 | 339 | Carbamidomethylation |
| K.EEQSQITSQVTGQIGWR.R | N | Y | 11.62 | 4.90 | 1.7 | 1.1187E6 |  |
 |
1.8696E6 | 6.2449E5 | 8.6212E5 | 2.99 | 1 | 146 | 162 | |
| K.DIILPFR.V | N | Y | 4.74 | 0.78 | 1.0 | 2.4272E5 |  |
 |
2.5249E5 | 3.2409E5 | 2.7782E5 | 1.28 | 1 | 282 | 288 | |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.QSIAIDDC(+57.02)TFHQC(+57.02)VR.L | Y | Y | 7.08 | 6.15 | 1.0 | 3.3236E6 | |
|
6.8177E6 | 1.4017E6 | 1.7514E6 | 4.86 | 1 | 237 | 251 | Carbamidomethylation |
| K.WARPPISMNFEVPFAPSGLK.V | Y | Y | 4.03 | 6.56 | 2.2 | 2.8277E6 | |
|
6.0441E6 | 9.0584E5 | 1.5331E6 | 6.67 | 1 | 379 | 398 | |
| K.ESQISAEIELLPTNDK.K | Y | Y | 5.37 | 0.75 | 1.5 | 1.5356E6 | |
|
1.7595E6 | 1.4132E6 | 1.4342E6 | 1.25 | 1 | 361 | 376 | |
| R.IPTPLNTSGVQVIC(+57.02)MK.G | N | Y | 7.38 | 2.44 | 0.8 | 1.3127E6 | |
|
2.0034E6 | 8.0914E5 | 1.1257E6 | 2.48 | 1 | 322 | 337 | Carbamidomethylation |
| K.EEQSQITSQVTGQIGWR.R | N | Y | 11.62 | 4.90 | 1.7 | 1.1187E6 | |
|
1.8696E6 | 6.2449E5 | 8.6212E5 | 2.99 | 1 | 144 | 160 | |
| K.DIILPFR.V | N | Y | 4.74 | 0.78 | 1.0 | 2.4272E5 | |
|
2.5249E5 | 3.2409E5 | 2.7782E5 | 1.28 | 1 | 280 | 286 | |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LDYEDIIDDLPC(+57.02)R.F | Y | Y | 5.04 | 4.64 | 0.7 | 9.1518E5 |  |
|
3.7222E5 | 1.4399E6 | 1.0265E6 | 3.87 | 1 | 506 | 518 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.YPASTVQILGAEK.A | Y | Y | 5.79 | 6.53 | 0.8 | 7.7649E6 |  |
 |
3.0588E6 | 1.2295E7 | 7.9409E6 | 4.02 | 1 | 321 | 333 | |
| R.IDC(+57.02)FSEVPTSVFGEK.L | Y | Y | 4.76 | 8.19 | 1.3 | 4.4099E6 |  |
 |
1.3029E6 | 6.9009E6 | 5.026E6 | 5.30 | 1 | 382 | 396 | Carbamidomethylation |
| K.LEEITMDGAK.A | Y | Y | 3.89 | 1.28 | 6.0 | 3.4471E6 |  |
 |
2.2911E6 | 4.1078E6 | 3.9425E6 | 1.79 | 1 | 231 | 240 | |
| K.IINDNATYC(+57.02)R.L | N | Y | 4.18 | 5.76 | 2.6 | 2.579E6 |  |
 |
9.3905E5 | 5.9445E6 | 2.3396E6 | 6.33 | 1 | 203 | 212 | Carbamidomethylation |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.TALTYYLDITNPPR.T | Y | Y | 4.66 | 11.12 | 2.6 | 4.424E6 |  |
 |
1.0198E7 | 1.3057E6 | 1.7684E6 | 7.81 | 1 | 369 | 382 | |
| R.NIIVFYGSQTGTAEEFANR.L | Y | Y | 2.85 | 5.44 | 2.8 | 9.985E5 |  |
 |
3.6054E6 | 1.4191E5 | 1.8503E5 | 25.41 | 1 | 79 | 97 | |
| K.EVGETLLYYGC(+57.02)R.R | Y | Y | 7.39 | 2.80 | 7.9 | 9.8571E5 |  |
 |
1.5345E6 | 5.9477E5 | 8.2787E5 | 2.58 | 1 | 556 | 567 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.TALTYYLDITNPPR.T | Y | Y | 4.66 | 11.12 | 2.6 | 4.424E6 | |
|
1.0198E7 | 1.3057E6 | 1.7684E6 | 7.81 | 1 | 375 | 388 | |
| R.NIIVFYGSQTGTAEEFANR.L | Y | Y | 2.85 | 5.44 | 2.8 | 9.985E5 | |
|
3.6054E6 | 1.4191E5 | 1.8503E5 | 25.41 | 1 | 85 | 103 | |
| K.EVGETLLYYGC(+57.02)R.R | Y | Y | 7.39 | 2.80 | 7.9 | 9.8571E5 | |
|
1.5345E6 | 5.9477E5 | 8.2787E5 | 2.58 | 1 | 562 | 573 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.TVVSGSC(+57.02)AAHSLLITTEGK.L | Y | Y | 9.09 | 3.61 | 1.1 | 1.1187E7 |  |
 |
4.5739E6 | 1.5163E7 | 1.4187E7 | 3.32 | 2 | 150 | 168 | Carbamidomethylation |
| R.DVAC(+57.02)GANHTLVLDSQK.R | Y | Y | 6.73 | 6.40 | 1.0 | 6.783E6 |  |
 |
2.3577E6 | 1.2235E7 | 8.8153E6 | 5.19 | 2 | 332 | 347 | Carbamidomethylation |
| K.GNLYSFGC(+57.02)PEYGQLGHNSDGK.F | Y | Y | 7.48 | 3.26 | 0.6 | 5.2574E6 |  |
 |
2.3474E6 | 7.5762E6 | 5.8487E6 | 3.23 | 1 | 271 | 291 | Carbamidomethylation |
| K.DGQILPVPNVVVR.D | N | Y | 5.06 | 5.35 | 0.4 | 3.8891E6 |  |
 |
1.4296E6 | 5.5836E6 | 4.6542E6 | 3.91 | 1 | 319 | 331 | |
| R.NLGQNLWGPHR.Y | N | Y | 3.38 | 4.82 | 6.2 | 3.2619E6 |  |
 |
3.8671E5 | 5.7187E6 | 3.6802E6 | 14.79 | 1 | 129 | 139 | |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SDDSVIQLLNPNR.Q | Y | Y | 4.38 | 6.44 | 0.5 | 3.9986E6 |  |
 |
8.1029E6 | 2.0355E6 | 1.8576E6 | 4.36 | 1 | 72 | 84 | |
| K.EDDGVPVIC(+57.02)QVEHPAVTGNLQTQR.Y | Y | Y | 14.13 | 9.24 | 1.5 | 6.4314E5 |  |
 |
1.4038E6 | 3.2271E5 | 2.0294E5 | 6.92 | 1 | 215 | 238 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SDDSVIQLLNPNR.Q | Y | Y | 4.38 | 6.44 | 0.5 | 3.9986E6 | |
|
8.1029E6 | 2.0355E6 | 1.8576E6 | 4.36 | 1 | 72 | 84 | |
| K.EDDGVPVIC(+57.02)QVEHPAVTGNLQTQR.Y | Y | Y | 14.13 | 9.24 | 1.5 | 6.4314E5 | |
|
1.4038E6 | 3.2271E5 | 2.0294E5 | 6.92 | 1 | 215 | 238 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SDDSVIQLLNPNR.Q | Y | Y | 4.38 | 6.44 | 0.5 | 3.9986E6 | |
|
8.1029E6 | 2.0355E6 | 1.8576E6 | 4.36 | 1 | 72 | 84 | |
| K.EDDGVPVIC(+57.02)QVEHPAVTGNLQTQR.Y | Y | Y | 14.13 | 9.24 | 1.5 | 6.4314E5 | |
|
1.4038E6 | 3.2271E5 | 2.0294E5 | 6.92 | 1 | 215 | 238 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SDDSVIQLLNPNR.Q | Y | Y | 4.38 | 6.44 | 0.5 | 3.9986E6 | |
|
8.1029E6 | 2.0355E6 | 1.8576E6 | 4.36 | 1 | 72 | 84 | |
| K.EDDGVPVIC(+57.02)QVEHPAVTGNLQTQR.Y | Y | Y | 14.13 | 9.24 | 1.5 | 6.4314E5 | |
|
1.4038E6 | 3.2271E5 | 2.0294E5 | 6.92 | 1 | 215 | 238 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VVTEEVTTTTTTITEK.H | Y | Y | 6.75 | 14.26 | 1.3 | 3.2218E5 | |
|
8.5558E5 | 4.7508E4 | 6.3439E4 | 18.01 | 1 | 830 | 845 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VVTEEVTTTTTTITEK.H | Y | Y | 6.75 | 14.26 | 1.3 | 3.2218E5 | |
|
8.5558E5 | 4.7508E4 | 6.3439E4 | 18.01 | 1 | 815 | 830 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VVTEEVTTTTTTITEK.H | Y | Y | 6.75 | 14.26 | 1.3 | 3.2218E5 | |
|
8.5558E5 | 4.7508E4 | 6.3439E4 | 18.01 | 1 | 794 | 809 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.TLEVEIEPGVR.D | Y | Y | 4.90 | 3.39 | 5.8 | 4.1834E6 |  |
 |
6.0301E6 | 1.8018E6 | 4.7183E6 | 3.35 | 1 | 207 | 217 | |
| R.FQMTQEVVC(+57.02)DEC(+57.02)PNVK.L | Y | Y | 10.15 | 5.52 | 0.7 | 1.925E6 |  |
 |
3.8911E6 | 8.8806E5 | 9.958E5 | 4.38 | 1 | 185 | 200 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.TLEVEIEPGVR.D | Y | Y | 4.90 | 3.39 | 5.8 | 4.1834E6 | |
|
6.0301E6 | 1.8018E6 | 4.7183E6 | 3.35 | 1 | 186 | 196 | |
| R.FQMTQEVVC(+57.02)DEC(+57.02)PNVK.L | Y | Y | 10.15 | 5.52 | 0.7 | 1.925E6 | |
|
3.8911E6 | 8.8806E5 | 9.958E5 | 4.38 | 1 | 164 | 179 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.TLEVEIEPGVR.D | Y | Y | 4.90 | 3.39 | 5.8 | 4.1834E6 | |
|
6.0301E6 | 1.8018E6 | 4.7183E6 | 3.35 | 1 | 197 | 207 | |
| R.FQMTQEVVC(+57.02)DEC(+57.02)PNVK.L | Y | Y | 10.15 | 5.52 | 0.7 | 1.925E6 | |
|
3.8911E6 | 8.8806E5 | 9.958E5 | 4.38 | 1 | 175 | 190 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IFVGGLSPDTPEEK.I | Y | Y | 5.46 | 3.67 | 1.0 | 8.3851E7 |  |
|
4.0968E7 | 1.1065E8 | 9.9937E7 | 2.70 | 1 | 182 | 195 | |
| R.GFC(+57.02)FITFK.E | Y | Y | 4.67 | 9.78 | 0.6 | 9.0318E6 |  |
 |
2.5906E6 | 1.346E7 | 1.1044E7 | 5.20 | 1 | 222 | 229 | Carbamidomethylation |
| K.MFIGGLSWDTTK.K | Y | Y | 3.20 | 3.50 | 1.8 | 8.8857E6 |  |
 |
1.802E6 | 1.4167E7 | 1.0688E7 | 7.86 | 1 | 97 | 108 | |
| R.EYFGGFGEVESIELPM(+15.99)DNK.T | N | Y | 3.30 | 3.25 | 1.1 | 2.7357E6 |  |
 |
9.6029E5 | 4.6233E6 | 2.8637E6 | 4.81 | 1 | 198 | 216 | Oxidation (M) |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.TAPYVVTGSVDQTVK.V | Y | Y | 5.90 | 7.39 | 0.7 | 1.1684E7 |  |
 |
2.4465E7 | 4.8045E6 | 5.7835E6 | 5.09 | 1 | 391 | 405 | |
| R.MVRPNQDGTLIASC(+57.02)SNDQTVR.V | Y | Y | 12.03 | 5.76 | 1.0 | 4.9947E6 |  |
 |
9.7297E6 | 2.4367E6 | 2.8177E6 | 3.99 | 1 | 239 | 259 | Carbamidomethylation |
| K.EEFTSGGPLGQK.R | Y | Y | 4.26 | 0.41 | 1.0 | 4.7884E6 |  |
 |
5.1244E6 | 4.8182E6 | 5.8969E6 | 1.22 | 1 | 77 | 88 | |
| K.VWDYETGDFER.T | N | Y | 5.68 | 8.78 | 0.7 | 3.3012E6 |  |
 |
6.7191E6 | 1.9031E6 | 1.2814E6 | 5.24 | 1 | 134 | 144 | |
| R.EHEHVVEC(+57.02)ISWAPESSYSSISEATGSETK.K | N | Y | 13.96 | 6.20 | 1.9 | 3.1994E6 |  |
 |
6.4773E6 | 1.632E6 | 1.7356E6 | 3.97 | 2 | 274 | 302 | Carbamidomethylation |
| K.LWDFQGFEC(+57.02)IR.T | N | Y | 5.19 | 3.96 | 0.5 | 2.1313E6 |  |
 |
3.4944E6 | 1.4051E6 | 1.4946E6 | 2.49 | 1 | 176 | 186 | Carbamidomethylation |
| K.LNEAKEEFTSGGPLGQK.R | N | Y | 5.73 | 14.44 | 0.9 | 1.02E6 |  |
 |
3.4182E6 | 2.6866E5 | 1.1494E6 | 12.72 | 1 | 72 | 88 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.TAASFDEC(+57.02)STAGVFLSTLHC(+57.02)QDYR.S | Y | Y | 11.43 | 5.66 | 1.1 | 1.0372E6 | |
|
4.2649E5 | 1.0572E6 | 1.6278E6 | 3.82 | 1 | 243 | 266 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.TAASFDEC(+57.02)STAGVFLSTLHC(+57.02)QDYR.S | Y | Y | 11.43 | 5.66 | 1.1 | 1.0372E6 | |
|
4.2649E5 | 1.0572E6 | 1.6278E6 | 3.82 | 1 | 242 | 265 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NPDQVYLVDYGLAYR.Y | Y | Y | 4.59 | 4.53 | 2.4 | 9.6494E5 | |
|
4.6027E5 | 1.6256E6 | 9.2396E5 | 3.53 | 1 | 189 | 203 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NPDQVYLVDYGLAYR.Y | Y | Y | 4.59 | 4.53 | 2.4 | 9.6494E5 | |
|
4.6027E5 | 1.6256E6 | 9.2396E5 | 3.53 | 1 | 189 | 203 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NPDQVYLVDYGLAYR.Y | Y | Y | 4.59 | 4.53 | 2.4 | 9.6494E5 | |
|
4.6027E5 | 1.6256E6 | 9.2396E5 | 3.53 | 1 | 189 | 203 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M.A(+42.01)DQLTEEQIAEFK.E | Y | Y | 6.09 | 4.42 | 1.0 | 1.3304E8 |  |
 |
2.2721E8 | 7.986E7 | 9.2048E7 | 2.85 | 1 | 2 | 14 | Acetylation (N-term) |
| K.EAFSLFDKDGDGTITTK.E | Y | Y | 5.76 | 3.37 | 1.2 | 7.51E7 |  |
 |
1.1187E8 | 4.8811E7 | 6.462E7 | 2.29 | 1 | 15 | 31 | |
| R.VFDKDGNGYISAAELR.H | Y | Y | 6.87 | 2.61 | 2.4 | 2.9289E7 |  |
 |
4.3107E7 | 1.9587E7 | 2.5173E7 | 2.20 | 2 | 92 | 107 | |
| K.EAFSLFDK.D | N | Y | 4.45 | 3.75 | 0.5 | 5.4192E6 |  |
 |
2.5547E6 | 7.8953E6 | 6.4461E6 | 3.09 | 1 | 15 | 22 | |
| K.DTDSEEEIR.E | N | Y | 3.88 | 0.55 | 0.6 | 3.5608E6 |  |
 |
4.1731E6 | 5.0563E6 | 3.7602E6 | 1.34 | 1 | 79 | 87 | |
| K.DGNGYISAAELR.H | N | Y | 5.85 | 0.51 | 0.5 | 1.9016E6 |  |
 |
1.6799E6 | 2.0393E6 | 1.9856E6 | 1.21 | 1 | 96 | 107 | |
| R.EADIDGDGQVNYEEFVQMM(+15.99)TAK | N | Y | 13.72 | 4.82 | 1.2 | 2.6141E5 |  |
 |
3.9818E5 | 1.2994E5 | 2.561E5 | 3.06 | 1 | 128 | 149 | Oxidation (M) |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M.A(+42.01)DQLTEEQIAEFK.E | Y | Y | 6.09 | 4.42 | 1.0 | 1.3304E8 | |
|
2.2721E8 | 7.986E7 | 9.2048E7 | 2.85 | 1 | 2 | 14 | Acetylation (N-term) |
| K.EAFSLFDKDGDGTITTK.E | Y | Y | 5.76 | 3.37 | 1.2 | 7.51E7 | |
|
1.1187E8 | 4.8811E7 | 6.462E7 | 2.29 | 1 | 15 | 31 | |
| R.VFDKDGNGYISAAELR.H | Y | Y | 6.87 | 2.61 | 2.4 | 2.9289E7 | |
|
4.3107E7 | 1.9587E7 | 2.5173E7 | 2.20 | 2 | 92 | 107 | |
| K.EAFSLFDK.D | N | Y | 4.45 | 3.75 | 0.5 | 5.4192E6 | |
|
2.5547E6 | 7.8953E6 | 6.4461E6 | 3.09 | 1 | 15 | 22 | |
| K.DTDSEEEIR.E | N | Y | 3.88 | 0.55 | 0.6 | 3.5608E6 | |
|
4.1731E6 | 5.0563E6 | 3.7602E6 | 1.34 | 1 | 79 | 87 | |
| K.DGNGYISAAELR.H | N | Y | 5.85 | 0.51 | 0.5 | 1.9016E6 | |
|
1.6799E6 | 2.0393E6 | 1.9856E6 | 1.21 | 1 | 96 | 107 | |
| R.EADIDGDGQVNYEEFVQMM(+15.99)TAK | N | Y | 13.72 | 4.82 | 1.2 | 2.6141E5 | |
|
3.9818E5 | 1.2994E5 | 2.561E5 | 3.06 | 1 | 128 | 149 | Oxidation (M) |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M.A(+42.01)DQLTEEQIAEFK.E | Y | Y | 6.09 | 4.42 | 1.0 | 1.3304E8 | |
|
2.2721E8 | 7.986E7 | 9.2048E7 | 2.85 | 1 | 2 | 14 | Acetylation (N-term) |
| K.EAFSLFDKDGDGTITTK.E | Y | Y | 5.76 | 3.37 | 1.2 | 7.51E7 | |
|
1.1187E8 | 4.8811E7 | 6.462E7 | 2.29 | 1 | 15 | 31 | |
| R.VFDKDGNGYISAAELR.H | Y | Y | 6.87 | 2.61 | 2.4 | 2.9289E7 | |
|
4.3107E7 | 1.9587E7 | 2.5173E7 | 2.20 | 2 | 92 | 107 | |
| K.EAFSLFDK.D | N | Y | 4.45 | 3.75 | 0.5 | 5.4192E6 | |
|
2.5547E6 | 7.8953E6 | 6.4461E6 | 3.09 | 1 | 15 | 22 | |
| K.DTDSEEEIR.E | N | Y | 3.88 | 0.55 | 0.6 | 3.5608E6 | |
|
4.1731E6 | 5.0563E6 | 3.7602E6 | 1.34 | 1 | 79 | 87 | |
| K.DGNGYISAAELR.H | N | Y | 5.85 | 0.51 | 0.5 | 1.9016E6 | |
|
1.6799E6 | 2.0393E6 | 1.9856E6 | 1.21 | 1 | 96 | 107 | |
| R.EADIDGDGQVNYEEFVQMM(+15.99)TAK | N | Y | 13.72 | 4.82 | 1.2 | 2.6141E5 | |
|
3.9818E5 | 1.2994E5 | 2.561E5 | 3.06 | 1 | 128 | 149 | Oxidation (M) |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.C(+57.02)TLC(+57.02)SQPGATIGC(+57.02)EIK.A | Y | Y | 12.12 | 6.88 | 1.0 | 7.8961E5 | |
|
2.3495E5 | 9.8095E5 | 1.2117E6 | 5.16 | 1 | 280 | 295 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LGEVVNTHGPVEPDKDNIR.Q | Y | Y | 6.81 | 3.61 | 0.8 | 6.1857E6 | |
|
1.0609E7 | 4.0314E6 | 4.925E6 | 2.63 | 2 | 128 | 146 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LGEVVNTHGPVEPDKDNIR.Q | Y | Y | 6.81 | 3.61 | 0.8 | 6.1857E6 | |
|
1.0609E7 | 4.0314E6 | 4.925E6 | 2.63 | 2 | 128 | 146 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.WEWLVNQHR.D | Y | Y | 6.67 | 5.79 | 0.6 | 8.4079E5 | |
|
3.3011E5 | 1.1328E6 | 1.0595E6 | 3.43 | 1 | 29 | 37 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.GLLGLPEEETELDNLTEFNTAHNK.R | Y | Y | 7.14 | 4.44 | 0.7 | 2.7887E6 | |
|
1.3439E6 | 4.5143E6 | 2.5079E6 | 3.36 | 1 | 152 | 175 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.EDLRLPEGDLGK.E | Y | Y | 5.84 | 6.56 | 0.6 | 2.3502E7 |  |
 |
9.2926E6 | 2.3115E7 | 3.8097E7 | 4.10 | 1 | 110 | 121 | |
| R.EDLRLPEGDLGKEIEQK.Y | N | Y | 8.64 | 5.06 | 0.6 | 2.3469E6 |  |
 |
1.5278E6 | 7.9199E5 | 4.7209E6 | 5.96 | 1 | 110 | 126 | |
| R.LPEGDLGKEIEQK.Y | Y | Y | 8.07 | 4.43 | 1.7 | 5.7651E5 |  |
 |
6.2374E5 | 2.6668E5 | 9.0578E5 | 3.40 | 1 | 114 | 126 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.EDLRLPEGDLGK.E | Y | Y | 5.84 | 6.56 | 0.6 | 2.3502E7 | |
|
9.2926E6 | 2.3115E7 | 3.8097E7 | 4.10 | 1 | 110 | 121 | |
| R.EDLRLPEGDLGKEIEQK.Y | N | Y | 8.64 | 5.06 | 0.6 | 2.3469E6 | |
|
1.5278E6 | 7.9199E5 | 4.7209E6 | 5.96 | 1 | 110 | 126 | |
| R.LPEGDLGKEIEQK.Y | Y | Y | 8.07 | 4.43 | 1.7 | 5.7651E5 | |
|
6.2374E5 | 2.6668E5 | 9.0578E5 | 3.40 | 1 | 114 | 126 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VAVGELTDEDVK.M | Y | Y | 5.18 | 4.79 | 0.8 | 1.0926E7 |  |
 |
3.7868E6 | 1.2044E7 | 1.6947E7 | 4.48 | 1 | 452 | 463 | |
| R.ESLVVNYEDLAAR.E | Y | Y | 4.94 | 10.03 | 1.2 | 7.4195E6 |  |
 |
1.3935E6 | 9.8068E6 | 1.1058E7 | 7.94 | 1 | 229 | 241 | |
| K.AGIVTSLQAR.C | Y | Y | 5.50 | 4.33 | 3.9 | 5.9124E6 |  |
 |
2.6626E6 | 5.7997E6 | 9.2751E6 | 3.48 | 1 | 615 | 624 | |
| R.GLALALFGGEPK.N | N | Y | 4.35 | 3.15 | 0.6 | 4.9173E6 |  |
 |
2.7244E6 | 5.8272E6 | 7.5624E6 | 2.78 | 1 | 495 | 506 | |
| R.TSGVVTSC(+57.02)TGVLPQLSMVK.Y | N | Y | 5.28 | 13.41 | 0.9 | 4.1908E6 |  |
 |
9.0856E5 | 4.2617E6 | 7.4021E6 | 8.15 | 1 | 309 | 327 | Carbamidomethylation |
| R.ISHLPLVEELR.S | N | Y | 4.76 | 8.97 | 0.8 | 4.1243E6 |  |
 |
1.3294E6 | 4.5117E6 | 6.8643E6 | 5.16 | 1 | 286 | 296 | |
| R.YDPSLTFSENVDLTEPIISR.F | N | Y | 6.04 | 3.62 | 0.5 | 3.926E6 |  |
 |
1.784E6 | 5.1035E6 | 4.8905E6 | 2.86 | 1 | 638 | 657 | |
| K.QLVAEQVTYQR.N | N | Y | 3.63 | 1.02 | 0.4 | 3.7766E6 |  |
 |
8.4313E6 | 4.5743E6 | 5.7912E6 | 1.84 | 1 | 839 | 849 | |
| R.TSIHEAMEQQSISISK.A | N | Y | 6.49 | 0.76 | 3.0 | 5.8441E6 |  |
 |
4.9451E6 | 6.1145E6 | 6.4728E6 | 1.31 | 2 | 599 | 614 | |
| R.VMLESFIDTQK.F | N | Y | 4.46 | 4.71 | 0.5 | 3.4543E6 |  |
 |
1.3999E6 | 3.4963E6 | 5.4666E6 | 3.90 | 1 | 798 | 808 | |
| R.C(+57.02)TVIAAANPIGGR.Y | N | Y | 4.35 | 0.68 | 4.9 | 3.4437E6 |  |
 |
3.2584E6 | 3.053E6 | 4.0198E6 | 1.32 | 1 | 625 | 637 | Carbamidomethylation |
| R.AIFTTGQGASAVGLTAYVQR.H | N | Y | 5.85 | 4.77 | 0.8 | 2.9898E6 |  |
 |
1.2671E6 | 2.8844E6 | 4.818E6 | 3.80 | 1 | 544 | 563 | |
| R.DTVDPVQDEMLAR.F | N | Y | 4.98 | 11.06 | 1.8 | 1.7945E6 |  |
 |
5.4212E5 | 1.4826E6 | 3.3587E6 | 6.20 | 1 | 666 | 678 | |
| total 13 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LLSTSPALQGTPASR.G | Y | Y | 7.80 | 8.85 | 0.9 | 7.2326E5 | |
|
1.3726E5 | 1.2203E6 | 8.1221E5 | 8.89 | 1 | 579 | 593 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IIFDDFR.E | Y | Y | 4.58 | 3.70 | 0.6 | 2.6589E6 |  |
 |
9.6547E5 | 3.2512E6 | 3.76E6 | 3.89 | 1 | 548 | 554 | |
| K.ENDYYTPTGEFR.V | Y | Y | 5.95 | 17.70 | 1.0 | 2.5849E6 |  |
 |
4.2968E5 | 3.6023E6 | 3.8301E6 | 8.91 | 1 | 662 | 673 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IIFDDFR.E | Y | Y | 4.58 | 3.70 | 0.6 | 2.6589E6 | |
|
9.6547E5 | 3.2512E6 | 3.76E6 | 3.89 | 1 | 500 | 506 | |
| K.ENDYYTPTGEFR.V | Y | Y | 5.95 | 17.70 | 1.0 | 2.5849E6 | |
|
4.2968E5 | 3.6023E6 | 3.8301E6 | 8.91 | 1 | 614 | 625 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.GHLDAELDAYMAQTDPETND | Y | Y | 10.78 | 7.20 | 1.1 | 7.4501E5 | |
|
1.8366E5 | 1.0655E6 | 9.8586E5 | 5.80 | 1 | 190 | 209 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.DVQMLQDAISK.M | Y | Y | 4.18 | 11.10 | 0.9 | 3.8528E7 |  |
 |
2.8757E6 | 5.5583E7 | 5.7125E7 | 19.86 | 1 | 314 | 324 | |
| K.EGEEAGPGDPLLEAVPK.A | Y | Y | 6.22 | 0.33 | 0.8 | 1.8236E7 |  |
 |
1.9555E7 | 1.7625E7 | 1.7529E7 | 1.12 | 1 | 354 | 370 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.KNPEVPVNFAEFSK.K | Y | Y | 6.21 | 12.09 | 0.5 | 3.7806E6 | |
|
6.9715E5 | 4.7765E6 | 5.8683E6 | 8.42 | 1 | 34 | 47 | |
| K.NPEVPVNFAEFSK.K | N | Y | 6.27 | 9.08 | 1.4 | 3.2762E6 |  |
 |
1.1594E6 | 4.2498E6 | 4.4195E6 | 3.81 | 1 | 35 | 47 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.KNPEVPVNFAEFSK.K | Y | Y | 6.21 | 12.09 | 0.5 | 3.7806E6 | |
|
6.9715E5 | 4.7765E6 | 5.8683E6 | 8.42 | 1 | 34 | 47 | |
| K.NPEVPVNFAEFSK.K | N | Y | 6.27 | 9.08 | 1.4 | 3.2762E6 | |
|
1.1594E6 | 4.2498E6 | 4.4195E6 | 3.81 | 1 | 35 | 47 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.AIYFDGDFGQIVR.Y | Y | Y | 5.64 | 6.60 | 1.7 | 1.3067E6 | |
|
4.117E5 | 1.7073E6 | 1.8012E6 | 4.37 | 1 | 223 | 235 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AAC(+57.02)SAAAMEEDSEASSSR.M | Y | Y | 9.49 | 5.66 | 1.9 | 2.787E5 | |
|
6.4544E5 | 8.9759E4 | 1.2336E5 | 7.19 | 1 | 189 | 206 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AAC(+57.02)SAAAMEEDSEASSSR.M | Y | Y | 9.49 | 5.66 | 1.9 | 2.787E5 | |
|
6.4544E5 | 8.9759E4 | 1.2336E5 | 7.19 | 1 | 188 | 205 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VVGFHVLGPNAGEVTQGFAAALK.C | Y | Y | 6.47 | 4.15 | 0.4 | 7.8747E6 |  |
 |
1.4093E7 | 4.9451E6 | 4.586E6 | 3.07 | 1 | 435 | 457 | |
| R.YLGIPGDKEYC(+57.02)ISSDDLFSLPYC(+57.02)PGK.T | Y | Y | 6.12 | 3.56 | 0.6 | 3.6966E6 |  |
 |
6.2302E6 | 2.339E6 | 2.5206E6 | 2.66 | 1 | 167 | 192 | Carbamidomethylation |
| K.EYC(+57.02)ISSDDLFSLPYC(+57.02)PGK.T | N | Y | 6.46 | 2.01 | 1.3 | 7.3196E5 |  |
 |
7.6109E5 | 9.2222E5 | 5.1258E5 | 1.80 | 1 | 175 | 192 | Carbamidomethylation |
| K.IGEHMEEHGIK.F | Y | Y | 9.18 | 1.40 | 1.9 | 5.5266E5 |  |
 |
8.0767E5 | 5.1037E5 | 4.6753E5 | 1.73 | 2 | 236 | 246 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VVGFHVLGPNAGEVTQGFAAALK.C | Y | Y | 6.47 | 4.15 | 0.4 | 7.8747E6 | |
|
1.4093E7 | 4.9451E6 | 4.586E6 | 3.07 | 1 | 435 | 457 | |
| R.YLGIPGDKEYC(+57.02)ISSDDLFSLPYC(+57.02)PGK.T | Y | Y | 6.12 | 3.56 | 0.6 | 3.6966E6 | |
|
6.2302E6 | 2.339E6 | 2.5206E6 | 2.66 | 1 | 167 | 192 | Carbamidomethylation |
| K.EYC(+57.02)ISSDDLFSLPYC(+57.02)PGK.T | N | Y | 6.46 | 2.01 | 1.3 | 7.3196E5 | |
|
7.6109E5 | 9.2222E5 | 5.1258E5 | 1.80 | 1 | 175 | 192 | Carbamidomethylation |
| K.IGEHMEEHGIK.F | Y | Y | 9.18 | 1.40 | 1.9 | 5.5266E5 | |
|
8.0767E5 | 5.1037E5 | 4.6753E5 | 1.73 | 2 | 236 | 246 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.YLFNC(+57.02)GEGVQR.L | Y | Y | 5.80 | 8.78 | 0.3 | 1.6061E6 | |
|
5.6395E5 | 1.7593E6 | 2.4951E6 | 4.42 | 1 | 77 | 87 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.YLFNC(+57.02)GEGVQR.L | Y | Y | 5.80 | 8.78 | 0.3 | 1.6061E6 | |
|
5.6395E5 | 1.7593E6 | 2.4951E6 | 4.42 | 1 | 77 | 87 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.YLFNC(+57.02)GEGVQR.L | Y | Y | 5.80 | 8.78 | 0.3 | 1.6061E6 | |
|
5.6395E5 | 1.7593E6 | 2.4951E6 | 4.42 | 1 | 77 | 87 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.YLFNC(+57.02)GEGVQR.L | Y | Y | 5.80 | 8.78 | 0.3 | 1.6061E6 | |
|
5.6395E5 | 1.7593E6 | 2.4951E6 | 4.42 | 1 | 77 | 87 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IISDNLTYC(+57.02)K.C | Y | Y | 5.53 | 5.42 | 0.7 | 5.6686E6 |  |
 |
2.0893E6 | 8.3084E6 | 6.6082E6 | 3.98 | 1 | 197 | 206 | Carbamidomethylation |
| K.YGLIYHASLVGQTSPK.H | Y | Y | 9.29 | 5.72 | 1.1 | 5.2747E6 |  |
 |
1.9577E6 | 7.4494E6 | 6.417E6 | 3.81 | 2 | 338 | 353 | |
| K.TYDPSGDSTLPTC(+57.02)SK.K | Y | Y | 6.43 | 6.35 | 0.3 | 4.1233E6 |  |
 |
1.9942E6 | 7.2375E6 | 4.9475E6 | 3.63 | 1 | 427 | 441 | Carbamidomethylation |
| R.SQMDGLIPGVEPR.E | N | Y | 5.34 | 5.09 | 0.9 | 4.0833E6 |  |
 |
1.6948E6 | 5.7622E6 | 4.7929E6 | 3.40 | 1 | 121 | 133 | |
| R.LIAHAGSLLNLAK.H | N | Y | 4.72 | 5.40 | 1.2 | 4.024E6 |  |
 |
1.4339E6 | 6.1133E6 | 4.5248E6 | 4.26 | 1 | 298 | 310 | |
| K.LNLSC(+57.02)IHSPVVNELMR.G | N | Y | 6.29 | 4.13 | 0.5 | 3.167E6 |  |
 |
1.4243E6 | 4.6099E6 | 3.4667E6 | 3.24 | 1 | 102 | 117 | Carbamidomethylation |
| K.HAASTVQILGAEK.A | N | Y | 4.68 | 9.23 | 0.9 | 1.9185E6 |  |
 |
7.6195E5 | 3.7298E6 | 2.9281E6 | 4.90 | 1 | 311 | 323 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IISDNLTYC(+57.02)K.C | Y | Y | 5.53 | 5.42 | 0.7 | 5.6686E6 | |
|
2.0893E6 | 8.3084E6 | 6.6082E6 | 3.98 | 1 | 195 | 204 | Carbamidomethylation |
| K.YGLIYHASLVGQTSPK.H | Y | Y | 9.29 | 5.72 | 1.1 | 5.2747E6 | |
|
1.9577E6 | 7.4494E6 | 6.417E6 | 3.81 | 2 | 336 | 351 | |
| K.TYDPSGDSTLPTC(+57.02)SK.K | Y | Y | 6.43 | 6.35 | 0.3 | 4.1233E6 | |
|
1.9942E6 | 7.2375E6 | 4.9475E6 | 3.63 | 1 | 425 | 439 | Carbamidomethylation |
| R.SQMDGLIPGVEPR.E | N | Y | 5.34 | 5.09 | 0.9 | 4.0833E6 | |
|
1.6948E6 | 5.7622E6 | 4.7929E6 | 3.40 | 1 | 119 | 131 | |
| R.LIAHAGSLLNLAK.H | N | Y | 4.72 | 5.40 | 1.2 | 4.024E6 | |
|
1.4339E6 | 6.1133E6 | 4.5248E6 | 4.26 | 1 | 296 | 308 | |
| K.LNLSC(+57.02)IHSPVVNELMR.G | N | Y | 6.29 | 4.13 | 0.5 | 3.167E6 | |
|
1.4243E6 | 4.6099E6 | 3.4667E6 | 3.24 | 1 | 100 | 115 | Carbamidomethylation |
| K.HAASTVQILGAEK.A | N | Y | 4.68 | 9.23 | 0.9 | 1.9185E6 | |
|
7.6195E5 | 3.7298E6 | 2.9281E6 | 4.90 | 1 | 309 | 321 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.TVSYNILADTYAQTEFSR.T | Y | Y | 7.58 | 5.10 | 1.3 | 1.1281E6 | |
|
4.2038E5 | 1.2974E6 | 1.6663E6 | 3.96 | 1 | 296 | 313 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.RDELTLEGIK.Q | Y | Y | 4.98 | 7.09 | 2.1 | 6.4156E6 |  |
 |
3.0895E6 | 9.9135E6 | 6.2437E6 | 3.21 | 1 | 243 | 252 | |
| K.QFFVAVER.E | Y | Y | 4.00 | 2.94 | 0.4 | 3.6878E6 |  |
 |
1.7258E6 | 5.8774E6 | 3.4602E6 | 3.41 | 1 | 253 | 260 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LASTLVHLGEYQAAVDGAR.K | Y | Y | 7.18 | 2.49 | 0.8 | 3.2314E7 |  |
 |
5.0406E7 | 2.4377E7 | 2.2159E7 | 2.27 | 2 | 1227 | 1245 | |
| R.RPLIDQVVQTALSETQDPEEVSVTVK.A | Y | Y | 8.27 | 3.51 | 1.8 | 2.7797E7 |  |
 |
4.7067E7 | 2.0782E7 | 1.5569E7 | 3.02 | 2 | 968 | 993 | |
| K.LHIIEVGTPPTGNQPFPK.K | Y | Y | 7.58 | 2.50 | 0.5 | 2.7106E7 |  |
 |
4.2215E7 | 1.8588E7 | 2.0517E7 | 2.27 | 2 | 228 | 245 | |
| R.ISGETIFVTAPHEATAGIIGVNR.K | N | Y | 12.15 | 2.34 | 0.7 | 2.5949E7 |  |
 |
3.8556E7 | 1.9511E7 | 1.9778E7 | 1.98 | 2 | 298 | 320 | |
| K.VIQC(+57.02)FAETGQVQK.I | N | Y | 5.86 | 2.34 | 0.7 | 2.359E7 |  |
 |
3.5133E7 | 1.7099E7 | 1.8539E7 | 2.05 | 1 | 488 | 500 | Carbamidomethylation |
| R.NNLAGAEELFAR.K | N | Y | 5.37 | 1.96 | 0.7 | 1.742E7 |  |
 |
2.1263E7 | 1.3203E7 | 1.7794E7 | 1.61 | 1 | 355 | 366 | |
| K.VSQPIEGHAASFAQFK.M | N | Y | 15.56 | 3.00 | 2.3 | 1.8198E7 |  |
 |
2.7081E7 | 1.2294E7 | 1.5218E7 | 2.20 | 2 | 190 | 205 | |
| K.IVLDNSVFSEHR.N | N | Y | 5.98 | 1.74 | 1.0 | 1.582E7 |  |
 |
2.1889E7 | 1.1975E7 | 1.3597E7 | 1.83 | 1 | 1011 | 1022 | |
| K.HELIEFR.R | N | Y | 5.17 | 2.02 | 0.6 | 1.4971E7 |  |
 |
2.5187E7 | 1.2176E7 | 1.3845E7 | 2.07 | 1 | 1502 | 1508 | |
| R.KFNALFAQGNYSEAAK.V | N | Y | 7.13 | 3.01 | 0.6 | 1.556E7 |  |
 |
2.2621E7 | 9.6871E6 | 1.4373E7 | 2.34 | 2 | 367 | 382 | |
| R.HSSLAGC(+57.02)QIINYR.T | N | Y | 5.90 | 1.60 | 1.8 | 1.5234E7 |  |
 |
1.9587E7 | 1.2063E7 | 1.4824E7 | 1.62 | 2 | 145 | 157 | Carbamidomethylation |
| K.IYIDSNNNPER.F | N | Y | 5.24 | 2.43 | 0.5 | 1.1901E7 |  |
 |
1.788E7 | 8.7807E6 | 1.1239E7 | 2.04 | 1 | 882 | 892 | |
| R.ALEHFTDLYDIK.R | N | Y | 6.11 | 1.49 | 1.7 | 1.9382E7 |  |
 |
2.5393E7 | 1.5278E7 | 1.7475E7 | 1.66 | 2 | 626 | 637 | |
| K.HDVVFLITK.Y | N | Y | 5.26 | 1.52 | 0.4 | 1.119E7 |  |
 |
1.5493E7 | 8.2911E6 | 9.7868E6 | 1.87 | 1 | 270 | 278 | |
| K.LLYNNVSNFGR.L | N | Y | 5.91 | 2.32 | 0.4 | 1.0662E7 |  |
 |
7.2312E6 | 1.0667E7 | 1.4087E7 | 1.95 | 1 | 1216 | 1226 | |
| R.RPISADSAIMNPASK.V | N | Y | 7.24 | 2.29 | 0.8 | 1.1125E7 |  |
|
1.6839E7 | 7.9863E6 | 1.0545E7 | 2.11 | 2 | 64 | 78 | |
| R.GQFSTDELVAEVEKR.N | N | Y | 8.91 | 4.07 | 0.8 | 8.5764E6 |  |
|
1.4011E7 | 4.5407E6 | 7.511E6 | 3.09 | 2 | 838 | 852 | |
| K.RDPHLAC(+57.02)VAYER.G | N | Y | 4.39 | 2.90 | 0.8 | 8.0453E6 |  |
 |
1.2536E7 | 5.0631E6 | 7.8023E6 | 2.48 | 1 | 912 | 923 | Carbamidomethylation |
| K.SVDPTLALSVYLR.A | N | Y | 4.62 | 3.22 | 0.5 | 7.984E6 |  |
 |
1.3161E7 | 5.842E6 | 4.9491E6 | 2.66 | 1 | 469 | 481 | |
| R.KDPELWGSVLLESNPYR.R | N | Y | 5.34 | 2.24 | 0.7 | 6.8137E6 |  |
 |
8.9604E6 | 5.9685E6 | 5.512E6 | 1.63 | 1 | 951 | 967 | |
| K.EVC(+57.02)FAC(+57.02)VDGK.E | N | Y | 5.19 | 4.35 | 0.6 | 6.7701E6 |  |
 |
3.2277E6 | 7.7487E6 | 9.334E6 | 2.89 | 1 | 1255 | 1264 | Carbamidomethylation |
| R.AYEFAER.C | N | Y | 4.28 | 0.83 | 0.7 | 6.6939E6 |  |
 |
6.6266E6 | 6.1361E6 | 8.8531E6 | 1.44 | 1 | 1095 | 1101 | |
| R.LAELEEFINGPNNAHIQQVGDR.C | N | Y | 8.25 | 2.43 | 1.2 | 6.6673E6 |  |
 |
9.519E6 | 4.5868E6 | 5.9505E6 | 2.08 | 2 | 1183 | 1204 | |
| R.QNLQIC(+57.02)VQVASK.Y | N | Y | 6.20 | 1.25 | 0.9 | 6.387E6 |  |
 |
7.7083E6 | 6.0548E6 | 5.398E6 | 1.43 | 1 | 677 | 688 | Carbamidomethylation |
| K.KAVDVFFPPEAQNDFPVAMQISEK.H | N | Y | 5.94 | 4.21 | 1.1 | 6.2903E6 |  |
 |
1.0932E7 | 3.5223E6 | 4.4165E6 | 3.10 | 1 | 246 | 269 | |
| K.EDKLEC(+57.02)SEELGDLVK.S | N | Y | 5.96 | 1.66 | 0.3 | 5.9611E6 |  |
 |
7.5907E6 | 4.9842E6 | 5.3083E6 | 1.52 | 1 | 454 | 468 | Carbamidomethylation |
| R.IAAYLFK.G | N | Y | 4.99 | 0.70 | 0.8 | 5.5266E6 |  |
 |
5.4233E6 | 4.788E6 | 6.3684E6 | 1.33 | 1 | 1510 | 1516 | |
| K.SVNESLNNLFITEEDYQALR.T | N | Y | 6.08 | 5.60 | 0.6 | 1.2728E7 |  |
 |
2.1295E7 | 8.8667E6 | 8.0226E6 | 2.65 | 2 | 1462 | 1481 | |
| K.NLILVVR.G | N | Y | 5.43 | 0.58 | 0.5 | 4.2395E6 |  |
 |
4.9747E6 | 3.8789E6 | 3.865E6 | 1.29 | 1 | 831 | 837 | |
| K.TLQIFNIEMK.S | N | Y | 5.05 | 0.91 | 0.4 | 3.9648E6 |  |
 |
4.4331E6 | 3.3088E6 | 4.1524E6 | 1.34 | 1 | 87 | 96 | |
| K.FNALFAQGNYSEAAK.V | N | Y | 6.62 | 0.35 | 0.5 | 3.8322E6 |  |
 |
3.6573E6 | 3.7104E6 | 4.1288E6 | 1.13 | 1 | 368 | 382 | |
| K.DAMQYASESK.D | N | Y | 5.08 | 2.10 | 0.5 | 3.6264E6 |  |
 |
2.7481E6 | 4.2197E6 | 5.6533E6 | 2.06 | 1 | 1536 | 1545 | |
| K.MEGNAEESTLFC(+57.02)FAVR.G | N | Y | 5.21 | 1.35 | 0.9 | 3.2585E6 |  |
 |
4.0234E6 | 2.5697E6 | 3.1826E6 | 1.57 | 1 | 206 | 221 | Carbamidomethylation |
| K.WLLLTGISAQQNR.V | N | Y | 4.96 | 1.62 | 0.5 | 2.9883E6 |  |
 |
2.0554E6 | 3.5147E6 | 3.3948E6 | 1.71 | 1 | 164 | 176 | |
| K.AHTMTDDVTFWK.W | N | Y | 3.21 | 0.70 | 6.3 | 2.305E6 |  |
 |
4.1158E6 | 2.7465E6 | 2.3577E6 | 1.75 | 1 | 101 | 112 | |
| K.QLPLVKPYLR.S | N | Y | 5.96 | 3.61 | 0.7 | 2.2848E6 |  |
 |
2.6145E6 | 1.3145E6 | 2.9255E6 | 2.23 | 1 | 1444 | 1453 | |
| R.FQEHLQLQNLGINPANIGFSTLTM(+15.99)ESDK.F | N | Y | 4.54 | 2.79 | 1.0 | 1.8696E6 |  |
 |
2.6837E6 | 1.7485E6 | 1.1766E6 | 2.28 | 1 | 9 | 36 | Oxidation (M) |
| R.KFDVNTSAVQVLIEHIGNLDR.A | N | Y | 9.20 | 22.62 | 2.6 | 7.0625E6 |  |
 |
1.5514E7 | 5.5298E6 | 2.7593E5 | 56.23 | 2 | 1074 | 1094 | |
| K.VGEQAQVVIIDMNDPSNPIR.R | N | Y | 6.18 | 3.16 | 0.9 | 5.7947E6 |  |
 |
8.7295E6 | 4.2699E6 | 4.3848E6 | 2.04 | 2 | 44 | 63 | |
| K.KVGYTPDWIFLLR.N | N | Y | 5.57 | 4.22 | 0.7 | 1.5556E6 |  |
 |
2.4962E6 | 9.0119E5 | 1.2695E6 | 2.77 | 1 | 507 | 519 | |
| R.IHEGC(+57.02)EEPATHNALAK.I | N | Y | 11.78 | 1.36 | 3.6 | 8.2654E6 |  |
 |
1.1085E7 | 7.884E6 | 7.7988E6 | 1.42 | 3 | 866 | 881 | Carbamidomethylation |
| R.GQC(+57.02)DLELINVC(+57.02)NENSLFK.S | N | Y | 6.59 | 1.73 | 0.5 | 9.1514E6 |  |
 |
1.3308E7 | 7.1525E6 | 6.9932E6 | 1.90 | 2 | 924 | 941 | Carbamidomethylation |
| R.AHMGMFTELAILYSK.F | N | Y | 10.42 | 3.84 | 1.0 | 1.1505E5 |  |
 |
2.0744E5 | 6.3295E4 | 7.4404E4 | 3.28 | 1 | 1312 | 1326 | |
| total 43 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.FGQDIISPLLSVK.E | Y | Y | 5.38 | 5.69 | 0.5 | 1.8936E6 |  |
 |
3.1046E6 | 1.3742E6 | 1.2022E6 | 2.58 | 1 | 37 | 49 | |
| R.LIDLHTNVATAVLEHIK.A | Y | Y | 7.43 | 3.96 | 0.6 | 6.4892E5 |  |
 |
1.1976E6 | 4.2208E5 | 3.2707E5 | 3.66 | 1 | 384 | 400 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.FGQDIISPLLSVK.E | Y | Y | 5.38 | 5.69 | 0.5 | 1.8936E6 | |
|
3.1046E6 | 1.3742E6 | 1.2022E6 | 2.58 | 1 | 46 | 58 | |
| R.LIDLHTNVATAVLEHIK.A | Y | Y | 7.43 | 3.96 | 0.6 | 6.4892E5 | |
|
1.1976E6 | 4.2208E5 | 3.2707E5 | 3.66 | 1 | 393 | 409 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LQAVEVVITHLAPGTK.H | Y | Y | 5.71 | 3.83 | 0.7 | 3.7615E6 |  |
 |
6.3945E6 | 2.3257E6 | 2.5642E6 | 2.75 | 1 | 121 | 136 | |
| K.GHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYK.M | Y | Y | 6.32 | 6.05 | 1.1 | 2.7254E6 |  |
 |
5.2814E6 | 1.6791E6 | 1.2156E6 | 4.34 | 1 | 75 | 110 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M.S(+42.01)LPLNPKPFLNGLTGKPVMVK.L | Y | Y | 6.20 | 4.22 | 0.6 | 2.1232E7 |  |
 |
1.0781E7 | 2.8113E7 | 2.4802E7 | 2.61 | 1 | 2 | 22 | Acetylation (N-term) |
| R.C(+57.02)NNVLYIR.G | Y | Y | 4.95 | 4.10 | 2.8 | 1.2255E7 |  |
 |
7.3203E6 | 1.0844E7 | 1.8601E7 | 2.54 | 1 | 66 | 73 | Carbamidomethylation |
| M.S(+42.01)LPLNPKPFLNGLTGKPVM(+15.99)VK.L | N | Y | 5.61 | 4.27 | 0.6 | 8.2928E6 |  |
 |
4.7495E6 | 1.066E7 | 9.4694E6 | 2.24 | 1 | 2 | 22 | Acetylation (N-term); Oxidation (M) |
| R.GVEEEEEDGEMRE | Y | Y | 5.91 | 7.37 | 0.6 | 6.7611E6 |  |
|
2.0447E6 | 9.7543E6 | 1.0923E7 | 5.34 | 1 | 74 | 86 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LQGDANNLHGFEVDSR.V | Y | Y | 5.71 | 5.01 | 1.0 | 4.0836E6 |  |
 |
1.9681E6 | 4.7761E6 | 6.7006E6 | 3.40 | 1 | 125 | 140 | |
| R.IEGDETSTEAATR.L | Y | Y | 4.53 | 3.20 | 1.5 | 2.5956E6 |  |
 |
1.4662E6 | 2.3985E6 | 3.922E6 | 2.67 | 1 | 99 | 111 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LVDEEPQLTK.R | Y | Y | 4.26 | 3.76 | 1.3 | 4.2779E6 |  |
 |
1.8123E6 | 5.0743E6 | 7.2158E6 | 3.98 | 1 | 607 | 616 | |
| K.LLTGELLPTDGMIR.K | Y | Y | 3.85 | 2.08 | 2.1 | 3.3104E6 |  |
 |
1.4224E6 | 3.9859E6 | 4.5227E6 | 3.18 | 1 | 443 | 456 | |
| K.WPGDILAYK.E | N | Y | 4.89 | 2.83 | 1.5 | 1.9407E6 |  |
 |
1.2637E6 | 1.1845E6 | 3.3738E6 | 2.85 | 1 | 592 | 600 | |
| K.IPPPVIMVQNVSFK.Y | Y | Y | 6.15 | 4.71 | 0.4 | 2.0042E6 |  |
 |
1.1257E6 | 2.0185E6 | 2.9605E6 | 2.63 | 2 | 392 | 405 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VVVLGLLPR.G | Y | Y | 5.09 | 5.01 | 0.4 | 5.3917E6 | |
|
1.0003E7 | 2.868E6 | 3.3037E6 | 3.49 | 1 | 134 | 142 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IC(+57.02)VLDVDLQGVR.S | Y | Y | 3.68 | 3.67 | 8.5 | 1.8138E6 | |
|
3.477E6 | 8.835E5 | 1.081E6 | 3.94 | 1 | 165 | 176 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IC(+57.02)VLDVDLQGVR.S | Y | Y | 3.68 | 3.67 | 8.5 | 1.8138E6 | |
|
3.477E6 | 8.835E5 | 1.081E6 | 3.94 | 1 | 106 | 117 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.HWILPQDYDHAQAEAR.H | Y | Y | 5.15 | 5.35 | 0.7 | 5.1654E6 |  |
 |
2.6179E6 | 5.8143E6 | 7.064E6 | 2.70 | 1 | 265 | 280 | |
| R.VVRPDSELGERPPEDNQSFQYDHEAFLGK.E | Y | Y | 20.18 | 10.42 | 1.1 | 1.3153E6 |  |
 |
4.2696E5 | 1.6871E6 | 1.9385E6 | 4.54 | 1 | 32 | 60 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NAC(+57.02)IEC(+57.02)SVNQNSIR.N | Y | Y | 9.39 | 3.87 | 0.8 | 1.7222E6 |  |
 |
3.0651E6 | 8.0754E5 | 1.4959E6 | 3.80 | 1 | 90 | 103 | Carbamidomethylation |
| R.ALTALFK.E | Y | Y | 4.47 | 1.66 | 0.8 | 8.516E5 |  |
 |
1.0792E6 | 5.3136E5 | 9.442E5 | 2.03 | 1 | 28 | 34 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NAC(+57.02)IEC(+57.02)SVNQNSIR.N | Y | Y | 9.39 | 3.87 | 0.8 | 1.7222E6 | |
|
3.0651E6 | 8.0754E5 | 1.4959E6 | 3.80 | 1 | 90 | 103 | Carbamidomethylation |
| R.ALTALFK.E | Y | Y | 4.47 | 1.66 | 0.8 | 8.516E5 | |
|
1.0792E6 | 5.3136E5 | 9.442E5 | 2.03 | 1 | 28 | 34 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NAC(+57.02)IEC(+57.02)SVNQNSIR.N | Y | Y | 9.39 | 3.87 | 0.8 | 1.7222E6 | |
|
3.0651E6 | 8.0754E5 | 1.4959E6 | 3.80 | 1 | 90 | 103 | Carbamidomethylation |
| R.ALTALFK.E | Y | Y | 4.47 | 1.66 | 0.8 | 8.516E5 | |
|
1.0792E6 | 5.3136E5 | 9.442E5 | 2.03 | 1 | 28 | 34 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.GLPWSC(+57.02)SADEVQR.F | Y | Y | 5.92 | 2.51 | 0.6 | 3.3644E7 |  |
|
1.7888E7 | 4.0213E7 | 4.2832E7 | 2.39 | 1 | 17 | 29 | Carbamidomethylation |
| R.YVELFLNSTAGASGGAYEHR.Y | Y | Y | 5.37 | 3.76 | 1.2 | 2.3417E7 |  |
 |
1.3646E7 | 2.7453E7 | 2.9153E7 | 2.14 | 2 | 356 | 375 | |
| K.SNNVEMDWVLK.H | Y | Y | 6.00 | 3.38 | 0.5 | 1.2836E7 |  |
 |
6.1204E6 | 1.5025E7 | 1.7363E7 | 2.84 | 1 | 88 | 98 | |
| R.VTGEADVEFATHEDAVAAMSK.D | N | Y | 5.77 | 3.71 | 1.6 | 1.2384E7 |  |
 |
6.0697E6 | 1.3493E7 | 1.7589E7 | 2.90 | 2 | 327 | 347 | |
| R.YGDGGSTFQSTTGHC(+57.02)VHMR.G | N | Y | 16.99 | 5.02 | 0.6 | 3.6867E6 |  |
 |
2.3334E6 | 4.1799E6 | 5.5917E6 | 2.40 | 1 | 276 | 294 | Carbamidomethylation |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.GLPWSC(+57.02)SADEVQR.F | Y | Y | 5.92 | 2.51 | 0.6 | 3.3644E7 | |
|
1.7888E7 | 4.0213E7 | 4.2832E7 | 2.39 | 1 | 17 | 29 | Carbamidomethylation |
| R.YVELFLNSTAGASGGAYEHR.Y | Y | Y | 5.37 | 3.76 | 1.2 | 2.3417E7 | |
|
1.3646E7 | 2.7453E7 | 2.9153E7 | 2.14 | 2 | 356 | 375 | |
| K.SNNVEMDWVLK.H | Y | Y | 6.00 | 3.38 | 0.5 | 1.2836E7 | |
|
6.1204E6 | 1.5025E7 | 1.7363E7 | 2.84 | 1 | 88 | 98 | |
| R.VTGEADVEFATHEDAVAAMSK.D | N | Y | 5.77 | 3.71 | 1.6 | 1.2384E7 | |
|
6.0697E6 | 1.3493E7 | 1.7589E7 | 2.90 | 2 | 327 | 347 | |
| R.YGDGGSTFQSTTGHC(+57.02)VHMR.G | N | Y | 16.99 | 5.02 | 0.6 | 3.6867E6 | |
|
2.3334E6 | 4.1799E6 | 5.5917E6 | 2.40 | 1 | 276 | 294 | Carbamidomethylation |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LQPFATEADVEEALR.L | Y | Y | 14.70 | 2.39 | 0.6 | 7.966E6 |  |
 |
6.3148E6 | 6.2529E6 | 1.133E7 | 1.81 | 1 | 628 | 642 | |
| K.LQELPDAVPHGEMPR.H | Y | Y | 6.05 | 2.69 | 2.2 | 6.8677E6 |  |
 |
5.038E6 | 5.0016E6 | 1.0563E7 | 2.11 | 1 | 229 | 243 | |
| K.C(+57.02)SPIGVYTSGK.G | Y | Y | 4.38 | 10.78 | 1.0 | 4.1976E6 |  |
 |
7.7864E5 | 4.3579E6 | 7.4562E6 | 9.58 | 1 | 397 | 407 | Carbamidomethylation |
| K.AIAC(+57.02)LLFGGSR.K | N | Y | 4.64 | 2.66 | 0.6 | 4.0869E6 |  |
 |
2.1693E6 | 4.4119E6 | 5.6795E6 | 2.62 | 1 | 352 | 362 | Carbamidomethylation |
| R.WDETKGEDNIDFMPTILSR.F | N | Y | 5.35 | 3.57 | 0.8 | 2.0281E6 |  |
 |
1.2081E6 | 1.8102E6 | 3.066E6 | 2.54 | 1 | 495 | 513 | |
| R.VAIHEAMEQQTISIAK.A | N | Y | 8.01 | 2.63 | 0.9 | 7.4566E5 |  |
 |
4.5145E5 | 7.6437E5 | 1.0212E6 | 2.26 | 1 | 456 | 471 | |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.STTSTIESFAAQEK.Q | Y | Y | 8.31 | 2.93 | 0.5 | 4.7242E6 |  |
 |
2.0077E6 | 6.1111E6 | 6.0538E6 | 3.04 | 1 | 174 | 187 | |
| R.LALSQNQQSSGAAGPTGK.N | Y | Y | 6.90 | 4.77 | 0.8 | 3.2558E6 |  |
 |
1.612E6 | 4.7927E6 | 4.5609E6 | 2.97 | 1 | 107 | 124 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.STTSTIESFAAQEK.Q | Y | Y | 8.31 | 2.93 | 0.5 | 4.7242E6 | |
|
2.0077E6 | 6.1111E6 | 6.0538E6 | 3.04 | 1 | 174 | 187 | |
| R.LALSQNQQSSGAAGPTGK.N | Y | Y | 6.90 | 4.77 | 0.8 | 3.2558E6 | |
|
1.612E6 | 4.7927E6 | 4.5609E6 | 2.97 | 1 | 107 | 124 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.STTSTIESFAAQEK.Q | Y | Y | 8.31 | 2.93 | 0.5 | 4.7242E6 | |
|
2.0077E6 | 6.1111E6 | 6.0538E6 | 3.04 | 1 | 174 | 187 | |
| R.LALSQNQQSSGAAGPTGK.N | Y | Y | 6.90 | 4.77 | 0.8 | 3.2558E6 | |
|
1.612E6 | 4.7927E6 | 4.5609E6 | 2.97 | 1 | 107 | 124 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.STTSTIESFAAQEK.Q | Y | Y | 8.31 | 2.93 | 0.5 | 4.7242E6 | |
|
2.0077E6 | 6.1111E6 | 6.0538E6 | 3.04 | 1 | 162 | 175 | |
| R.LALSQNQQSSGAAGPTGK.N | Y | Y | 6.90 | 4.77 | 0.8 | 3.2558E6 | |
|
1.612E6 | 4.7927E6 | 4.5609E6 | 2.97 | 1 | 95 | 112 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.AQAALAVNISAAR.G | Y | Y | 7.08 | 2.50 | 0.5 | 2.1145E7 |  |
 |
1.3349E7 | 2.0834E7 | 2.9252E7 | 2.19 | 1 | 16 | 28 | |
| K.TEVNSGFFYK.S | Y | Y | 5.45 | 2.52 | 0.9 | 1.6685E7 |  |
 |
1.0733E7 | 1.6499E7 | 2.2824E7 | 2.13 | 1 | 242 | 251 | |
| K.EGIVALR.R | Y | Y | 4.47 | 6.61 | 0.7 | 5.2083E6 |  |
 |
8.4881E5 | 6.5344E6 | 8.4539E6 | 9.96 | 1 | 308 | 314 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ATFYGEQVDYYK.S | Y | Y | 6.34 | 2.81 | 1.1 | 3.9511E6 |  |
 |
5.919E6 | 2.2044E6 | 3.7298E6 | 2.69 | 1 | 1517 | 1528 | |
| K.TLQALQIPAAK.L | Y | Y | 5.19 | 8.00 | 0.6 | 2.9344E6 |  |
 |
4.7968E6 | 1.272E6 | 2.7343E6 | 3.77 | 1 | 557 | 567 | |
| K.TEVSLTLTNK.F | Y | Y | 4.99 | 4.83 | 0.8 | 2.9202E6 |  |
 |
5.1191E6 | 1.1153E6 | 2.526E6 | 4.59 | 1 | 1359 | 1368 | |
| K.LGLAPQIQDLYGK.V | N | Y | 5.97 | 4.39 | 0.5 | 2.6897E6 |  |
 |
4.8643E6 | 1.4968E6 | 1.7079E6 | 3.25 | 1 | 162 | 174 | |
| K.VDQIQEIVTGNPTVIK.M | N | Y | 7.39 | 3.83 | 0.6 | 2.1962E6 |  |
 |
3.7011E6 | 1.0472E6 | 1.8402E6 | 3.53 | 1 | 1038 | 1053 | |
| R.EEIQSSISGVTAAYNR.E | N | Y | 13.09 | 3.78 | 0.6 | 2.1171E6 |  |
 |
3.3862E6 | 1.1075E6 | 1.8577E6 | 3.06 | 1 | 723 | 738 | |
| K.SWVNQMESQTGEASK.L | N | Y | 7.21 | 3.90 | 0.8 | 1.9538E6 |  |
 |
3.3552E6 | 1.0845E6 | 1.4217E6 | 3.09 | 1 | 1097 | 1111 | |
| R.SNQQLENDLNLMDIK.I | N | Y | 17.27 | 11.52 | 0.9 | 1.3182E6 |  |
 |
1.9711E6 | 5.9459E5 | 1.389E6 | 3.32 | 1 | 902 | 916 | |
| K.MFLGDNAHLSIINEYLSQSYQK.F | N | Y | 6.30 | 5.24 | 2.1 | 1.2389E6 |  |
 |
2.3078E6 | 8.4376E5 | 5.6532E5 | 4.08 | 1 | 1240 | 1261 | |
| K.FDVPGDENAEMDAR.T | N | Y | 8.68 | 3.02 | 0.7 | 1.2358E6 |  |
 |
2.0306E6 | 6.5934E5 | 1.0174E6 | 3.08 | 1 | 1369 | 1382 | |
| K.FVHLLDQSDQDFQEELDLMK.M | N | Y | 5.70 | 6.37 | 1.0 | 1.1754E6 |  |
 |
2.1304E6 | 6.3519E5 | 7.6068E5 | 3.35 | 1 | 872 | 891 | |
| K.VDFTEEEINNMK.I | N | Y | 5.22 | 3.94 | 1.8 | 1.1279E6 |  |
 |
1.7173E6 | 7.9412E5 | 8.7229E5 | 2.16 | 1 | 175 | 186 | |
| K.SKVDQIQEIVTGNPTVIK.M | N | Y | 15.92 | 17.45 | 1.0 | 3.3029E5 |  |
 |
7.5391E5 | 6.3629E4 | 1.7334E5 | 11.85 | 1 | 1036 | 1053 | |
| total 13 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.QGNLFDFLR.L | Y | Y | 6.06 | 7.97 | 1.0 | 6.5678E5 | |
|
1.3008E6 | 3.0279E5 | 3.668E5 | 4.30 | 1 | 456 | 464 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.QGNLFDFLR.L | Y | Y | 6.06 | 7.97 | 1.0 | 6.5678E5 | |
|
1.3008E6 | 3.0279E5 | 3.668E5 | 4.30 | 1 | 369 | 377 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.TIVITSHPGQIVK.H | Y | Y | 5.83 | 5.58 | 0.8 | 1.324E7 |  |
 |
6.6125E6 | 1.5064E7 | 1.8042E7 | 2.73 | 2 | 284 | 296 | |
| K.QISQAYEVLADSK.K | Y | Y | 5.28 | 5.71 | 0.7 | 7.3747E6 |  |
 |
2.9632E6 | 9.5001E6 | 1.0402E7 | 3.51 | 1 | 47 | 59 | |
| R.IHQIGPGMVQQIQSVC(+57.02)MEC(+57.02)QGHGER.I | Y | Y | 8.00 | 3.75 | 0.7 | 4.4753E6 |  |
 |
2.1601E6 | 4.8948E6 | 6.3711E6 | 2.95 | 1 | 162 | 186 | Carbamidomethylation |
| K.C(+57.02)VLNEGMPIYR.R | N | Y | 4.28 | 2.74 | 2.1 | 2.1012E6 |  |
 |
1.0982E6 | 2.1464E6 | 3.0589E6 | 2.79 | 1 | 302 | 312 | Carbamidomethylation |
| K.NVVHQLSVTLEDLYNGATR.K | N | Y | 5.35 | 3.67 | 0.9 | 2.0471E6 |  |
 |
9.499E5 | 2.6057E6 | 2.5856E6 | 2.74 | 1 | 106 | 124 | |
| K.ETTYYDVLGVKPNATQEELKK.A | N | Y | 10.91 | 3.22 | 2.0 | 1.4644E6 |  |
 |
7.0263E5 | 2.0845E6 | 1.7817E6 | 2.97 | 1 | 4 | 24 | |
| K.EVEETDEMDQVELVDFDPNQER.R | N | Y | 5.75 | 15.49 | 1.1 | 1.5416E6 |  |
 |
2.6038E5 | 2.077E6 | 2.3585E6 | 9.06 | 2 | 351 | 372 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.YVVVTGITPTPLGEGK.S | Y | Y | 5.74 | 3.71 | 0.6 | 1.3139E7 |  |
 |
7.3346E6 | 1.5277E7 | 1.6804E7 | 2.29 | 1 | 371 | 386 | |
| R.LDIDPETITWQR.V | Y | Y | 4.21 | 4.06 | 0.5 | 8.7063E6 |  |
 |
3.0306E6 | 1.124E7 | 1.1848E7 | 3.91 | 1 | 521 | 532 | |
| K.MHGGGPTVTAGLPLPK.A | Y | Y | 5.39 | 4.63 | 0.9 | 6.0434E6 |  |
 |
3.1688E6 | 6.466E6 | 8.4953E6 | 2.68 | 1 | 706 | 721 | |
| R.KVVGDVAYDEAK.E | N | Y | 4.03 | 2.92 | 0.4 | 3.9807E6 |  |
 |
2.1632E6 | 4.767E6 | 6.2036E6 | 2.87 | 1 | 251 | 262 | |
| K.VVGDVAYDEAK.E | N | Y | 4.99 | 3.66 | 0.6 | 3.5401E6 |  |
 |
1.8709E6 | 4.5485E6 | 5.3379E6 | 2.85 | 1 | 252 | 262 | |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VGTAQLALVAR.A | Y | Y | 11.44 | 3.49 | 0.7 | 1.1083E6 |  |
 |
1.7464E6 | 6.893E5 | 8.8926E5 | 2.53 | 1 | 461 | 471 | |
| R.LGLQYSQGLVSGSNAR.C | Y | Y | 14.02 | 2.86 | 0.7 | 7.9862E5 |  |
 |
1.1598E6 | 5.4095E5 | 6.9513E5 | 2.14 | 1 | 253 | 268 | |
| R.VQTDAFVSNELDDPDDLQC(+57.02)K.R | Y | Y | 21.48 | 3.63 | 1.2 | 3.7116E5 |  |
 |
5.4887E5 | 2.4022E5 | 3.2437E5 | 2.28 | 1 | 490 | 509 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VGTAQLALVAR.A | Y | Y | 11.44 | 3.49 | 0.7 | 1.1083E6 | |
|
1.7464E6 | 6.893E5 | 8.8926E5 | 2.53 | 1 | 419 | 429 | |
| R.LGLQYSQGLVSGSNAR.C | Y | Y | 14.02 | 2.86 | 0.7 | 7.9862E5 | |
|
1.1598E6 | 5.4095E5 | 6.9513E5 | 2.14 | 1 | 211 | 226 | |
| R.VQTDAFVSNELDDPDDLQC(+57.02)K.R | Y | Y | 21.48 | 3.63 | 1.2 | 3.7116E5 | |
|
5.4887E5 | 2.4022E5 | 3.2437E5 | 2.28 | 1 | 448 | 467 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VFASLPQVER.G | Y | Y | 3.32 | 3.29 | 5.5 | 7.2907E6 |  |
 |
1.0138E7 | 1.2935E7 | 2.0326E6 | 6.36 | 1 | 8 | 17 | |
| R.LATGSDDNC(+57.02)AAFFEGPPFK.F | Y | Y | 5.13 | 2.99 | 1.6 | 7.0877E6 |  |
 |
1.1888E7 | 4.226E6 | 5.1493E6 | 2.81 | 1 | 162 | 180 | Carbamidomethylation |
| K.AHDGGIYAISWSPDSTHLLSASGDK.T | Y | Y | 7.96 | 4.59 | 0.4 | 2.8755E6 |  |
 |
5.54E6 | 1.4769E6 | 1.6097E6 | 3.75 | 1 | 232 | 256 | |
| K.YEYQPFAGK.I | N | Y | 4.44 | 3.49 | 9.2 | 2.5834E6 |  |
 |
4.2861E6 | 1.2296E6 | 2.2343E6 | 3.49 | 1 | 96 | 104 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.DVATVAFC(+57.02)DAQSTQEIHEK.V | Y | Y | 6.79 | 3.10 | 1.5 | 4.1279E6 |  |
 |
6.2787E6 | 2.9881E6 | 3.2154E6 | 2.10 | 2 | 36 | 54 | Carbamidomethylation |
| R.GAALDVHESEPFSFSQGPLK.D | Y | Y | 5.57 | 5.84 | 0.8 | 3.1799E6 |  |
 |
5.898E6 | 1.7394E6 | 1.9022E6 | 3.39 | 1 | 275 | 294 | |
| R.IGSGFDNIDIK.S | Y | Y | 6.53 | 4.17 | 0.5 | 2.9105E6 |  |
 |
5.1151E6 | 1.5107E6 | 2.1056E6 | 3.39 | 1 | 87 | 97 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.DVATVAFC(+57.02)DAQSTQEIHEK.V | Y | Y | 6.79 | 3.10 | 1.5 | 4.1279E6 | |
|
6.2787E6 | 2.9881E6 | 3.2154E6 | 2.10 | 2 | 36 | 54 | Carbamidomethylation |
| R.GAALDVHESEPFSFSQGPLK.D | Y | Y | 5.57 | 5.84 | 0.8 | 3.1799E6 | |
|
5.898E6 | 1.7394E6 | 1.9022E6 | 3.39 | 1 | 275 | 294 | |
| R.IGSGFDNIDIK.S | Y | Y | 6.53 | 4.17 | 0.5 | 2.9105E6 | |
|
5.1151E6 | 1.5107E6 | 2.1056E6 | 3.39 | 1 | 87 | 97 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.DVATVAFC(+57.02)DAQSTQEIHEK.V | Y | Y | 6.79 | 3.10 | 1.5 | 4.1279E6 | |
|
6.2787E6 | 2.9881E6 | 3.2154E6 | 2.10 | 2 | 36 | 54 | Carbamidomethylation |
| R.GAALDVHESEPFSFSQGPLK.D | Y | Y | 5.57 | 5.84 | 0.8 | 3.1799E6 | |
|
5.898E6 | 1.7394E6 | 1.9022E6 | 3.39 | 1 | 275 | 294 | |
| R.IGSGFDNIDIK.S | Y | Y | 6.53 | 4.17 | 0.5 | 2.9105E6 | |
|
5.1151E6 | 1.5107E6 | 2.1056E6 | 3.39 | 1 | 87 | 97 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.DVATVAFC(+57.02)DAQSTQEIHEK.V | Y | Y | 6.79 | 3.10 | 1.5 | 4.1279E6 | |
|
6.2787E6 | 2.9881E6 | 3.2154E6 | 2.10 | 2 | 47 | 65 | Carbamidomethylation |
| R.GAALDVHESEPFSFSQGPLK.D | Y | Y | 5.57 | 5.84 | 0.8 | 3.1799E6 | |
|
5.898E6 | 1.7394E6 | 1.9022E6 | 3.39 | 1 | 286 | 305 | |
| R.IGSGFDNIDIK.S | Y | Y | 6.53 | 4.17 | 0.5 | 2.9105E6 | |
|
5.1151E6 | 1.5107E6 | 2.1056E6 | 3.39 | 1 | 98 | 108 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.TTLTAAITK.I | Y | Y | 4.15 | 1.94 | 1.3 | 1.6502E7 |  |
|
9.766E6 | 2.0829E7 | 2.4117E7 | 2.47 | 1 | 71 | 79 | |
| K.VEAQVYILSK.E | Y | Y | 5.81 | 4.62 | 0.6 | 1.115E7 |  |
 |
5.9598E6 | 1.2289E7 | 1.5202E7 | 2.55 | 1 | 352 | 361 | |
| R.GITINAAHVEYSTAAR.H | Y | Y | 8.23 | 3.26 | 0.9 | 6.5998E6 |  |
 |
3.6554E6 | 6.8064E6 | 9.3377E6 | 2.55 | 1 | 105 | 120 | |
| R.TVVTGIEMFHK.S | N | Y | 4.98 | 5.90 | 1.0 | 5.6056E6 |  |
 |
3.0283E6 | 5.9165E6 | 7.872E6 | 2.60 | 1 | 301 | 311 | |
| K.QIGVEHVVVYVNK.A | N | Y | 11.02 | 3.28 | 0.6 | 5.9608E6 |  |
 |
2.9147E6 | 7.4701E6 | 7.4977E6 | 2.57 | 2 | 170 | 182 | |
| K.YEEIDNAPEER.A | N | Y | 5.28 | 5.07 | 0.6 | 4.7142E6 |  |
 |
2.3713E6 | 6.5441E6 | 6.8633E6 | 2.89 | 1 | 92 | 102 | |
| K.KYEEIDNAPEER.A | N | Y | 5.78 | 3.56 | 0.9 | 4.6697E6 |  |
 |
2.5068E6 | 5.8886E6 | 7.0859E6 | 2.83 | 2 | 91 | 102 | |
| R.DKPHVNVGTIGHVDHGK.T | N | Y | 5.61 | 2.61 | 0.9 | 5.3873E6 |  |
 |
4.2488E6 | 6.9004E6 | 6.7377E6 | 1.62 | 3 | 54 | 70 | |
| total 8 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VVVPPLPGK.A | Y | Y | 5.51 | 2.41 | 0.5 | 3.5547E6 |  |
 |
5.4047E6 | 2.4399E6 | 2.8197E6 | 2.22 | 1 | 87 | 95 | |
| R.GDDGIFDDNFIEER.K | Y | Y | 6.70 | 2.14 | 0.6 | 2.4517E6 |  |
|
3.789E6 | 1.6777E6 | 1.8883E6 | 2.26 | 1 | 105 | 118 | |
| R.LITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGR.G | Y | Y | 11.44 | 6.77 | 0.8 | 1.2899E6 |  |
 |
2.6848E6 | 6.0366E5 | 5.8122E5 | 4.62 | 1 | 11 | 43 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.DETEFYLGK.R | Y | Y | 4.87 | 5.01 | 0.6 | 3.0984E7 |  |
|
1.4715E7 | 3.6399E7 | 4.1837E7 | 2.84 | 1 | 37 | 45 | |
| K.IEGVYAR.D | Y | Y | 4.47 | 2.11 | 0.8 | 2.5374E7 |  |
 |
1.5658E7 | 3.0861E7 | 3.7319E7 | 2.38 | 1 | 30 | 36 | |
| K.AIFAGYK.R | Y | Y | 5.84 | 1.88 | 0.8 | 1.3203E7 |  |
 |
9.1605E6 | 1.4444E7 | 1.6004E7 | 1.75 | 1 | 9 | 15 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.DETEFYLGK.R | Y | Y | 4.87 | 5.01 | 0.6 | 3.0984E7 | |
|
1.4715E7 | 3.6399E7 | 4.1837E7 | 2.84 | 1 | 37 | 45 | |
| K.IEGVYAR.D | Y | Y | 4.47 | 2.11 | 0.8 | 2.5374E7 | |
|
1.5658E7 | 3.0861E7 | 3.7319E7 | 2.38 | 1 | 30 | 36 | |
| K.AIFAGYK.R | Y | Y | 5.84 | 1.88 | 0.8 | 1.3203E7 | |
|
9.1605E6 | 1.4444E7 | 1.6004E7 | 1.75 | 1 | 9 | 15 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.DETEFYLGK.R | Y | Y | 4.87 | 5.01 | 0.6 | 3.0984E7 | |
|
1.4715E7 | 3.6399E7 | 4.1837E7 | 2.84 | 1 | 37 | 45 | |
| K.IEGVYAR.D | Y | Y | 4.47 | 2.11 | 0.8 | 2.5374E7 | |
|
1.5658E7 | 3.0861E7 | 3.7319E7 | 2.38 | 1 | 30 | 36 | |
| K.AIFAGYK.R | Y | Y | 5.84 | 1.88 | 0.8 | 1.3203E7 | |
|
9.1605E6 | 1.4444E7 | 1.6004E7 | 1.75 | 1 | 9 | 15 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.DETEFYLGK.R | Y | Y | 4.87 | 5.01 | 0.6 | 3.0984E7 | |
|
1.4715E7 | 3.6399E7 | 4.1837E7 | 2.84 | 1 | 44 | 52 | |
| K.IEGVYAR.D | Y | Y | 4.47 | 2.11 | 0.8 | 2.5374E7 | |
|
1.5658E7 | 3.0861E7 | 3.7319E7 | 2.38 | 1 | 37 | 43 | |
| K.AIFAGYK.R | Y | Y | 5.84 | 1.88 | 0.8 | 1.3203E7 | |
|
9.1605E6 | 1.4444E7 | 1.6004E7 | 1.75 | 1 | 16 | 22 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.DETEFYLGK.R | Y | Y | 4.87 | 5.01 | 0.6 | 3.0984E7 | |
|
1.4715E7 | 3.6399E7 | 4.1837E7 | 2.84 | 1 | 59 | 67 | |
| K.IEGVYAR.D | Y | Y | 4.47 | 2.11 | 0.8 | 2.5374E7 | |
|
1.5658E7 | 3.0861E7 | 3.7319E7 | 2.38 | 1 | 52 | 58 | |
| K.AIFAGYK.R | Y | Y | 5.84 | 1.88 | 0.8 | 1.3203E7 | |
|
9.1605E6 | 1.4444E7 | 1.6004E7 | 1.75 | 1 | 31 | 37 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.DETEFYLGK.R | Y | Y | 4.87 | 5.01 | 0.6 | 3.0984E7 | |
|
1.4715E7 | 3.6399E7 | 4.1837E7 | 2.84 | 1 | 37 | 45 | |
| K.IEGVYAR.D | Y | Y | 4.47 | 2.11 | 0.8 | 2.5374E7 | |
|
1.5658E7 | 3.0861E7 | 3.7319E7 | 2.38 | 1 | 30 | 36 | |
| K.AIFAGYK.R | Y | Y | 5.84 | 1.88 | 0.8 | 1.3203E7 | |
|
9.1605E6 | 1.4444E7 | 1.6004E7 | 1.75 | 1 | 9 | 15 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.DETEFYLGK.R | Y | Y | 4.87 | 5.01 | 0.6 | 3.0984E7 | |
|
1.4715E7 | 3.6399E7 | 4.1837E7 | 2.84 | 1 | 37 | 45 | |
| K.IEGVYAR.D | Y | Y | 4.47 | 2.11 | 0.8 | 2.5374E7 | |
|
1.5658E7 | 3.0861E7 | 3.7319E7 | 2.38 | 1 | 30 | 36 | |
| K.AIFAGYK.R | Y | Y | 5.84 | 1.88 | 0.8 | 1.3203E7 | |
|
9.1605E6 | 1.4444E7 | 1.6004E7 | 1.75 | 1 | 9 | 15 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IQIAPDSGGLPER.S | Y | Y | 5.92 | 2.53 | 0.3 | 1.1773E7 |  |
 |
5.8975E6 | 1.4746E7 | 1.4676E7 | 2.50 | 1 | 123 | 135 | |
| R.IGGNEGIDVPIPR.F | Y | Y | 5.53 | 7.05 | 0.6 | 9.4493E6 |  |
 |
3.7169E6 | 1.3136E7 | 1.1495E7 | 3.53 | 1 | 261 | 273 | |
| R.GTPQQIDYAR.Q | Y | Y | 5.10 | 3.20 | 0.6 | 7.4931E6 |  |
 |
4.3317E6 | 1.051E7 | 1.0265E7 | 2.43 | 1 | 420 | 429 | |
| R.IAQITGPPDR.C | N | Y | 4.60 | 6.01 | 0.7 | 7.4678E6 |  |
 |
3.0377E6 | 1.1373E7 | 1.0836E7 | 3.74 | 1 | 311 | 320 | |
| K.MVMIQDGPQNTGADKPLR.I | N | Y | 7.41 | 3.78 | 1.2 | 6.0513E6 |  |
 |
2.7554E6 | 7.5676E6 | 7.8308E6 | 2.84 | 1 | 208 | 225 | |
| R.SC(+57.02)MLTGTPESVQSAK.R | N | Y | 5.54 | 3.54 | 0.6 | 5.4595E6 |  |
 |
2.9051E6 | 6.8036E6 | 6.6698E6 | 2.34 | 1 | 136 | 150 | Carbamidomethylation |
| K.IGGDAGTSLNSNDYGYGGQK.R | N | Y | 6.52 | 4.10 | 1.2 | 3.9094E6 |  |
 |
1.7398E6 | 5.0964E6 | 4.8919E6 | 2.93 | 1 | 41 | 60 | |
| K.GRPAPGFHHGDGPGNAVQEIMIPASK.A | N | Y | 5.19 | 2.44 | 0.9 | 2.7767E6 |  |
 |
1.9827E6 | 3.8052E6 | 2.542E6 | 1.92 | 1 | 160 | 185 | |
| K.VPDGMVGFIIGR.G | N | Y | 6.19 | 3.74 | 0.3 | 1.4474E6 |  |
 |
7.916E5 | 1.77E6 | 1.7805E6 | 2.25 | 1 | 96 | 107 | |
| R.QQAAYYAQTSPQGMPQHPPAPQGQ | N | Y | 6.47 | 2.54 | 1.3 | 1.0051E6 |  |
 |
5.8175E5 | 1.2692E6 | 1.3097E6 | 2.25 | 1 | 610 | 633 | |
| R.C(+57.02)QHAAEIITDLLR.S | N | Y | 4.66 | 6.28 | 3.6 | 5.6627E5 |  |
 |
2.2116E5 | 5.9808E5 | 8.7956E5 | 3.98 | 1 | 321 | 333 | Carbamidomethylation |
| total 11 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IQIAPDSGGLPER.S | Y | Y | 5.92 | 2.53 | 0.3 | 1.1773E7 | |
|
5.8975E6 | 1.4746E7 | 1.4676E7 | 2.50 | 1 | 129 | 141 | |
| R.IGGNEGIDVPIPR.F | Y | Y | 5.53 | 7.05 | 0.6 | 9.4493E6 | |
|
3.7169E6 | 1.3136E7 | 1.1495E7 | 3.53 | 1 | 267 | 279 | |
| R.GTPQQIDYAR.Q | Y | Y | 5.10 | 3.20 | 0.6 | 7.4931E6 | |
|
4.3317E6 | 1.051E7 | 1.0265E7 | 2.43 | 1 | 426 | 435 | |
| R.IAQITGPPDR.C | N | Y | 4.60 | 6.01 | 0.7 | 7.4678E6 | |
|
3.0377E6 | 1.1373E7 | 1.0836E7 | 3.74 | 1 | 317 | 326 | |
| K.MVMIQDGPQNTGADKPLR.I | N | Y | 7.41 | 3.78 | 1.2 | 6.0513E6 | |
|
2.7554E6 | 7.5676E6 | 7.8308E6 | 2.84 | 1 | 214 | 231 | |
| R.SC(+57.02)MLTGTPESVQSAK.R | N | Y | 5.54 | 3.54 | 0.6 | 5.4595E6 | |
|
2.9051E6 | 6.8036E6 | 6.6698E6 | 2.34 | 1 | 142 | 156 | Carbamidomethylation |
| K.IGGDAGTSLNSNDYGYGGQK.R | N | Y | 6.52 | 4.10 | 1.2 | 3.9094E6 | |
|
1.7398E6 | 5.0964E6 | 4.8919E6 | 2.93 | 1 | 41 | 60 | |
| K.GRPAPGFHHGDGPGNAVQEIMIPASK.A | N | Y | 5.19 | 2.44 | 0.9 | 2.7767E6 | |
|
1.9827E6 | 3.8052E6 | 2.542E6 | 1.92 | 1 | 166 | 191 | |
| K.VPDGMVGFIIGR.G | N | Y | 6.19 | 3.74 | 0.3 | 1.4474E6 | |
|
7.916E5 | 1.77E6 | 1.7805E6 | 2.25 | 1 | 102 | 113 | |
| R.QQAAYYAQTSPQGMPQHPPAPQGQ | N | Y | 6.47 | 2.54 | 1.3 | 1.0051E6 | |
|
5.8175E5 | 1.2692E6 | 1.3097E6 | 2.25 | 1 | 616 | 639 | |
| R.C(+57.02)QHAAEIITDLLR.S | N | Y | 4.66 | 6.28 | 3.6 | 5.6627E5 | |
|
2.2116E5 | 5.9808E5 | 8.7956E5 | 3.98 | 1 | 327 | 339 | Carbamidomethylation |
| total 11 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IAC(+57.02)LDFSLQK.T | Y | Y | 5.94 | 3.25 | 0.8 | 1.8266E7 |  |
 |
9.3358E6 | 1.6483E7 | 2.898E7 | 3.10 | 1 | 234 | 243 | Carbamidomethylation |
| R.IC(+57.02)DDELILIK.N | Y | Y | 5.97 | 2.36 | 0.5 | 1.6888E7 |  |
 |
1.0946E7 | 1.6841E7 | 2.2878E7 | 2.09 | 1 | 356 | 365 | Carbamidomethylation |
| K.SSLGPVGLDK.M | Y | Y | 5.16 | 2.79 | 0.8 | 1.6569E7 |  |
 |
1.0942E7 | 1.6731E7 | 2.2034E7 | 2.01 | 1 | 34 | 43 | |
| K.FATEAAITILR.I | N | Y | 3.39 | 3.07 | 7.6 | 1.5392E7 |  |
 |
1.9357E7 | 5.1121E6 | 3.1386E7 | 6.14 | 1 | 516 | 526 | |
| R.TSASIILR.G | N | Y | 5.18 | 3.61 | 0.5 | 1.3945E7 |  |
 |
7.0533E6 | 1.4927E7 | 1.9855E7 | 2.82 | 1 | 371 | 378 | |
| R.EQLAIAEFAR.S | N | Y | 4.20 | 6.88 | 3.3 | 1.3508E7 |  |
 |
2.203E6 | 1.8181E7 | 2.0142E7 | 9.14 | 1 | 434 | 443 | |
| K.QAGVFEPTIVK.V | N | Y | 5.18 | 1.93 | 0.8 | 1.3067E7 |  |
 |
8.3305E6 | 1.3607E7 | 1.7264E7 | 2.07 | 1 | 500 | 510 | |
| K.LGVQVVITDPEK.L | N | Y | 7.37 | 2.12 | 0.6 | 1.306E7 |  |
 |
7.5837E6 | 1.5523E7 | 1.6075E7 | 2.12 | 1 | 248 | 259 | |
| R.YPVNSVNILK.A | N | Y | 3.87 | 1.27 | 7.8 | 1.2428E7 |  |
 |
9.0046E6 | 9.2646E6 | 1.9014E7 | 2.11 | 1 | 190 | 199 | |
| K.VLC(+57.02)ELADLQDK.E | N | Y | 5.30 | 2.83 | 0.6 | 1.0703E7 |  |
 |
5.7184E6 | 1.3668E7 | 1.2721E7 | 2.39 | 1 | 74 | 84 | Carbamidomethylation |
| R.AFHNEAQVNPER.K | N | Y | 5.00 | 1.46 | 1.5 | 1.0894E7 |  |
 |
8.0735E6 | 1.065E7 | 1.4161E7 | 1.75 | 2 | 469 | 480 | |
| K.LGVQVVITDPEKLDQIR.Q | N | Y | 10.57 | 2.81 | 0.8 | 1.0338E7 |  |
 |
6.4332E6 | 8.7333E6 | 1.5849E7 | 2.46 | 2 | 248 | 264 | |
| K.LLEVEHPAAK.V | N | Y | 4.97 | 3.56 | 0.8 | 1.3765E7 |  |
 |
8.0207E6 | 1.5142E7 | 2.1918E7 | 2.73 | 2 | 64 | 73 | |
| R.SQNVMAAASIANIVK.S | N | Y | 5.05 | 5.65 | 3.3 | 8.9522E6 |  |
 |
3.7764E6 | 9.2491E6 | 1.3831E7 | 3.66 | 1 | 19 | 33 | |
| K.YFVEAGAMAVR.R | N | Y | 4.72 | 1.82 | 3.0 | 8.1701E6 |  |
 |
1.1761E7 | 6.1247E6 | 6.6242E6 | 1.92 | 1 | 299 | 309 | |
| K.IHPTSVISGYR.L | N | Y | 4.66 | 3.67 | 0.6 | 5.5492E6 |  |
 |
3.5478E6 | 5.6001E6 | 8.8997E6 | 2.51 | 1 | 112 | 122 | |
| R.GANDFMC(+57.02)DEMER.S | N | Y | 6.08 | 7.80 | 0.4 | 5.2287E6 |  |
 |
2.2481E6 | 5.5918E6 | 7.8462E6 | 3.49 | 1 | 379 | 390 | Carbamidomethylation |
| R.SLHDALC(+57.02)VVK.R | N | Y | 5.81 | 6.54 | 3.0 | 1.2342E7 |  |
 |
6.8697E6 | 1.2338E7 | 1.7818E7 | 2.59 | 2 | 391 | 400 | Carbamidomethylation |
| K.ILATGANVILTTGGIDDMC(+57.02)LK.Y | N | Y | 5.03 | 3.23 | 0.9 | 8.4603E6 |  |
 |
4.6882E6 | 1.1422E7 | 9.2702E6 | 2.44 | 2 | 278 | 298 | Carbamidomethylation |
| K.M(+15.99)LVDDIGDVTITNDGATILK.L | N | Y | 2.91 | 4.08 | 1.2 | 2.4923E6 |  |
 |
3.2265E5 | 2.901E6 | 4.3339E6 | 13.43 | 1 | 44 | 63 | Oxidation (M) |
| K.MLVDDIGDVTITNDGATILK.L | N | Y | 5.73 | 2.86 | 0.5 | 8.1473E6 |  |
 |
4.9971E6 | 9.6399E6 | 9.805E6 | 1.96 | 2 | 44 | 63 | |
| total 21 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ASHTAPQVLFSHR.E | Y | Y | 5.51 | 2.88 | 0.6 | 4.6227E6 |  |
 |
7.9188E6 | 2.8913E6 | 3.7808E6 | 2.74 | 1 | 191 | 203 | |
| K.DSIVHQAGMLK.R | Y | Y | 4.05 | 0.65 | 5.6 | 1.4844E6 |  |
 |
1.7904E6 | 1.3126E6 | 1.6783E6 | 1.36 | 1 | 107 | 117 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ASHTAPQVLFSHR.E | Y | Y | 5.51 | 2.88 | 0.6 | 4.6227E6 | |
|
7.9188E6 | 2.8913E6 | 3.7808E6 | 2.74 | 1 | 191 | 203 | |
| K.DSIVHQAGMLK.R | Y | Y | 4.05 | 0.65 | 5.6 | 1.4844E6 | |
|
1.7904E6 | 1.3126E6 | 1.6783E6 | 1.36 | 1 | 107 | 117 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ASHTAPQVLFSHR.E | Y | Y | 5.51 | 2.88 | 0.6 | 4.6227E6 | |
|
7.9188E6 | 2.8913E6 | 3.7808E6 | 2.74 | 1 | 191 | 203 | |
| K.DSIVHQAGMLK.R | Y | Y | 4.05 | 0.65 | 5.6 | 1.4844E6 | |
|
1.7904E6 | 1.3126E6 | 1.6783E6 | 1.36 | 1 | 107 | 117 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ADFDNTVAIHPTSSEELVTLR | Y | Y | 8.42 | 5.17 | 1.0 | 6.895E6 |  |
 |
1.2302E7 | 3.5761E6 | 4.8798E6 | 3.44 | 2 | 482 | 502 | |
| K.VVGIHMQGIGC(+57.02)DEMLQGFAVAVK.M | Y | Y | 3.99 | 8.04 | 3.9 | 7.3532E5 |  |
 |
1.8718E6 | 1.696E5 | 3.2908E5 | 11.04 | 1 | 454 | 476 | Carbamidomethylation |
| K.GHILVDEFQNTNVK.G | Y | Y | 7.53 | 7.63 | 1.4 | 6.4765E5 |  |
 |
2.8356E5 | 1.4411E6 | 2.1831E5 | 6.60 | 1 | 335 | 348 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VLIIGGGDGGVLR.E | Y | Y | 6.78 | 3.38 | 1.6 | 5.6384E6 |  |
 |
2.7867E6 | 7.3345E6 | 6.7939E6 | 2.63 | 1 | 97 | 109 | |
| R.YQDILVFR.S | Y | Y | 5.96 | 4.36 | 0.5 | 3.8172E6 |  |
 |
1.9017E6 | 4.8075E6 | 4.7423E6 | 2.53 | 1 | 48 | 55 | |
| K.TYGNVLVLDGVIQC(+57.02)TER.D | Y | Y | 5.67 | 5.98 | 1.1 | 1.4185E6 |  |
 |
5.8226E5 | 2.2098E6 | 1.4635E6 | 3.80 | 1 | 58 | 74 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VLIIGGGDGGVLR.E | Y | Y | 6.78 | 3.38 | 1.6 | 5.6384E6 | |
|
2.7867E6 | 7.3345E6 | 6.7939E6 | 2.63 | 1 | 97 | 109 | |
| R.YQDILVFR.S | Y | Y | 5.96 | 4.36 | 0.5 | 3.8172E6 | |
|
1.9017E6 | 4.8075E6 | 4.7423E6 | 2.53 | 1 | 48 | 55 | |
| K.TYGNVLVLDGVIQC(+57.02)TER.D | Y | Y | 5.67 | 5.98 | 1.1 | 1.4185E6 | |
|
5.8226E5 | 2.2098E6 | 1.4635E6 | 3.80 | 1 | 58 | 74 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ENKPSIIFIDEIDSLC(+57.02)GSR.S | Y | Y | 5.90 | 5.68 | 0.8 | 1.0048E6 |  |
 |
1.8893E6 | 5.9999E5 | 5.2508E5 | 3.60 | 1 | 199 | 217 | Carbamidomethylation |
| K.AVATEANNSTFFSISSSDLVSK.W | Y | Y | 13.35 | 3.29 | 0.8 | 3.1078E5 |  |
 |
6.0978E5 | 2.3387E5 | 3.215E5 | 2.61 | 1 | 160 | 181 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ENKPSIIFIDEIDSLC(+57.02)GSR.S | Y | Y | 5.90 | 5.68 | 0.8 | 1.0048E6 | |
|
1.8893E6 | 5.9999E5 | 5.2508E5 | 3.60 | 1 | 224 | 242 | Carbamidomethylation |
| K.AVATEANNSTFFSISSSDLVSK.W | Y | Y | 13.35 | 3.29 | 0.8 | 3.1078E5 | |
|
6.0978E5 | 2.3387E5 | 3.215E5 | 2.61 | 1 | 185 | 206 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VEMENQIYAIPEDIMR.G | Y | Y | 3.77 | 12.33 | 3.8 | 1.3673E7 |  |
 |
8.0937E4 | 2.1008E7 | 1.9931E7 | 64.00 | 1 | 105 | 120 | |
| K.ASGC(+57.02)EGEDVVTLLK.E | Y | Y | 5.15 | 1.98 | 7.0 | 4.3075E6 |  |
 |
3.1995E6 | 5.2547E6 | 4.4681E6 | 1.64 | 1 | 625 | 638 | Carbamidomethylation |
| K.GAALITAVAC(+57.02)R.I | Y | Y | 5.44 | 1.42 | 7.0 | 2.5753E6 |  |
 |
2.4843E6 | 2.042E6 | 3.1998E6 | 1.57 | 1 | 900 | 910 | Carbamidomethylation |
| K.MLPTYVC(+57.02)ATPDGTEK.G | N | Y | 5.44 | 3.81 | 0.3 | 1.0256E6 |  |
 |
4.8593E5 | 1.0928E6 | 1.4981E6 | 3.08 | 1 | 511 | 525 | Carbamidomethylation |
| K.GLGATTHPTAAVK.M | N | Y | 7.58 | 1.62 | 1.1 | 1.304E5 |  |
 |
1.0411E5 | 1.4372E5 | 1.7931E5 | 1.72 | 1 | 50 | 62 | |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.INFYC(+57.02)PGSALGR.N | Y | Y | 6.68 | 4.33 | 0.5 | 5.5582E6 |  |
 |
2.6085E6 | 7.6702E6 | 6.3959E6 | 2.94 | 1 | 570 | 581 | Carbamidomethylation |
| K.AASITSEVFNK.F | Y | Y | 5.48 | 3.78 | 0.8 | 5.1325E6 |  |
 |
2.7801E6 | 6.6986E6 | 5.9187E6 | 2.41 | 1 | 186 | 196 | |
| K.APGEQTVPALNLQNAFR.I | Y | Y | 6.13 | 4.10 | 0.6 | 4.9736E6 |  |
 |
2.4067E6 | 6.3007E6 | 6.2133E6 | 2.62 | 1 | 607 | 623 | |
| K.ELAAQLNEEAK.R | N | Y | 4.67 | 7.98 | 2.1 | 4.9351E6 |  |
 |
1.7194E6 | 8.3914E6 | 6.7924E6 | 4.88 | 1 | 480 | 490 | |
| R.HTDVQFYTEVGEITTDLGK.H | N | Y | 8.10 | 2.63 | 1.2 | 3.2587E6 |  |
 |
1.9046E6 | 4.503E6 | 3.485E6 | 2.36 | 2 | 735 | 753 | |
| K.NISMSVEGDYTYLR.I | N | Y | 4.90 | 4.39 | 0.8 | 2.7625E6 |  |
 |
9.2335E5 | 3.8463E6 | 3.5178E6 | 4.17 | 1 | 556 | 569 | |
| K.VEALTKEELEFEVPFR.D | N | Y | 5.59 | 4.32 | 0.6 | 2.1715E6 |  |
 |
9.6761E5 | 2.9399E6 | 2.607E6 | 3.04 | 1 | 787 | 802 | |
| K.KYLAGADPSTVEMC(+57.02)YPPIIQSGGNYNLK.F | N | Y | 5.83 | 5.93 | 1.4 | 1.3539E6 |  |
|
6.414E5 | 1.5906E6 | 1.8298E6 | 2.85 | 1 | 229 | 256 | Carbamidomethylation |
| total 8 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.EPGTVALVSK.V | Y | Y | 4.73 | 3.08 | 0.7 | 5.8054E6 |  |
 |
3.0845E6 | 7.8386E6 | 8.4527E6 | 2.74 | 1 | 200 | 209 | |
| K.FDPYEHEALFHTPVEGK.E | Y | Y | 5.45 | 4.04 | 0.4 | 5.2679E6 |  |
 |
2.3468E6 | 6.439E6 | 7.018E6 | 2.99 | 1 | 183 | 199 | |
| R.TLRPALVGVVK.D | Y | Y | 4.67 | 3.58 | 0.8 | 4.0321E6 |  |
 |
2.1914E6 | 4.6502E6 | 5.2548E6 | 2.40 | 1 | 218 | 228 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.EPGTVALVSK.V | Y | Y | 4.73 | 3.08 | 0.7 | 5.8054E6 | |
|
3.0845E6 | 7.8386E6 | 8.4527E6 | 2.74 | 1 | 173 | 182 | |
| K.FDPYEHEALFHTPVEGK.E | Y | Y | 5.45 | 4.04 | 0.4 | 5.2679E6 | |
|
2.3468E6 | 6.439E6 | 7.018E6 | 2.99 | 1 | 156 | 172 | |
| R.TLRPALVGVVK.D | Y | Y | 4.67 | 3.58 | 0.8 | 4.0321E6 | |
|
2.1914E6 | 4.6502E6 | 5.2548E6 | 2.40 | 1 | 191 | 201 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.EPGTVALVSK.V | Y | Y | 4.73 | 3.08 | 0.7 | 5.8054E6 | |
|
3.0845E6 | 7.8386E6 | 8.4527E6 | 2.74 | 1 | 187 | 196 | |
| K.FDPYEHEALFHTPVEGK.E | Y | Y | 5.45 | 4.04 | 0.4 | 5.2679E6 | |
|
2.3468E6 | 6.439E6 | 7.018E6 | 2.99 | 1 | 170 | 186 | |
| R.TLRPALVGVVK.D | Y | Y | 4.67 | 3.58 | 0.8 | 4.0321E6 | |
|
2.1914E6 | 4.6502E6 | 5.2548E6 | 2.40 | 1 | 205 | 215 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IIFEDDR.C | Y | Y | 5.01 | 3.71 | 0.7 | 2.2739E7 |  |
 |
3.5301E7 | 1.4208E7 | 1.8707E7 | 2.48 | 1 | 31 | 37 | |
| R.C(+57.02)LAFHDISPQAPTHFLVIPK.K | Y | Y | 4.93 | 2.87 | 1.1 | 1.2143E7 |  |
 |
1.6318E7 | 7.0419E6 | 1.3068E7 | 2.32 | 1 | 38 | 57 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VVAEPVELAQEFR.K | Y | Y | 5.28 | 4.83 | 0.7 | 8.4143E6 |  |
 |
4.2452E6 | 9.0557E6 | 1.1942E7 | 2.81 | 1 | 219 | 231 | |
| R.ILTDYGFEGHPFR.K | Y | Y | 6.14 | 5.94 | 0.6 | 2.5527E6 |  |
 |
1.2669E6 | 2.8485E6 | 3.5428E6 | 2.80 | 1 | 187 | 199 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LAAQFIPK.F | Y | Y | 5.23 | 9.27 | 0.6 | 1.7102E7 |  |
 |
3.4543E6 | 2.2675E7 | 2.5177E7 | 7.29 | 1 | 44 | 51 | |
| R.NYGILADATEQVGQHK.D | Y | Y | 6.28 | 1.75 | 0.8 | 8.7665E6 |  |
 |
6.0221E6 | 9.8735E6 | 1.0404E7 | 1.73 | 2 | 10 | 25 | |
| K.ITNNINVLIK.D | N | Y | 5.59 | 2.58 | 0.6 | 3.3084E6 |  |
 |
1.9836E6 | 4.3265E6 | 3.6151E6 | 2.18 | 1 | 417 | 426 | |
| K.STVTLSWKPVQK.V | Y | Y | 7.09 | 1.60 | 0.7 | 4.3961E6 |  |
 |
3.3268E6 | 4.9506E6 | 5.4791E6 | 1.65 | 2 | 437 | 448 | |
| K.HFPELADSAINAQLDLC(+57.02)EDEDVSIR.R | N | Y | 4.37 | 1.86 | 1.1 | 1.9672E6 |  |
 |
1.3434E6 | 2.7997E6 | 1.7583E6 | 2.08 | 1 | 55 | 79 | Carbamidomethylation |
| R.QAVPLFSK.N | N | Y | 3.38 | 2.65 | 8.9 | 1.8346E6 |  |
 |
6.328E5 | 1.6658E6 | 3.3634E6 | 5.32 | 1 | 244 | 251 | |
| K.YSSNLGNFNYER.S | N | Y | 13.69 | 4.54 | 1.4 | 1.1186E6 |  |
|
4.8259E5 | 1.4582E6 | 1.4149E6 | 3.02 | 1 | 488 | 499 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VREEEIEVDSR.V | Y | Y | 4.28 | 8.69 | 7.3 | 3.2306E6 | |
|
4.9379E5 | 6.2227E6 | 4.5309E6 | 12.60 | 1 | 634 | 644 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VQISPDSGGLPER.S | Y | Y | 5.98 | 2.89 | 0.8 | 1.7836E7 |  |
 |
9.3256E6 | 2.3421E7 | 2.0761E7 | 2.51 | 1 | 179 | 191 | |
| K.AINQQTGAFVEISR.Q | Y | Y | 5.28 | 4.14 | 0.5 | 1.3579E7 |  |
 |
6.8503E6 | 1.7048E7 | 1.6838E7 | 2.49 | 1 | 450 | 463 | |
| R.SVSLTGAPESVQK.A | Y | Y | 5.77 | 3.22 | 0.6 | 1.2008E7 |  |
|
6.9974E6 | 1.7072E7 | 1.6224E7 | 2.44 | 1 | 192 | 204 | |
| R.IINDLLQSLR.S | N | Y | 5.18 | 3.85 | 1.8 | 1.0489E7 |  |
 |
5.0002E6 | 1.2788E7 | 1.3679E7 | 2.74 | 1 | 386 | 395 | |
| R.HSVGVVIGR.S | N | Y | 5.25 | 2.92 | 0.6 | 9.6309E6 |  |
 |
5.0303E6 | 1.3594E7 | 1.3667E7 | 2.72 | 1 | 333 | 341 | |
| R.VPDGMVGLIIGR.G | N | Y | 5.02 | 4.66 | 0.6 | 5.4227E6 |  |
 |
2.3024E6 | 7.4663E6 | 6.4994E6 | 3.24 | 1 | 152 | 163 | |
| K.VQQAC(+57.02)EMVMDILR.E | N | Y | 4.99 | 5.65 | 0.5 | 5.2579E6 |  |
 |
1.7632E6 | 7.3953E6 | 6.6153E6 | 4.19 | 1 | 293 | 305 | Carbamidomethylation |
| K.IGQQPQQPGAPPQQDYTK.A | N | Y | 7.46 | 3.30 | 0.6 | 4.7656E6 |  |
 |
2.6859E6 | 7.3214E6 | 6.1198E6 | 2.73 | 1 | 630 | 647 | |
| K.QAQVATGGGPGAPPGSQPDYSAAWAEYYR.Q | N | Y | 9.57 | 1.89 | 1.6 | 3.8059E6 |  |
 |
2.3353E6 | 5.3024E6 | 4.3637E6 | 2.27 | 2 | 656 | 684 | |
| K.KIGQQPQQPGAPPQQDYTK.A | N | Y | 18.13 | 3.10 | 0.8 | 1.3123E6 |  |
 |
9.3752E5 | 1.7046E6 | 1.7211E6 | 1.84 | 1 | 629 | 647 | |
| total 10 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VQISPDSGGLPER.S | Y | Y | 5.98 | 2.89 | 0.8 | 1.7836E7 | |
|
9.3256E6 | 2.3421E7 | 2.0761E7 | 2.51 | 1 | 179 | 191 | |
| K.AINQQTGAFVEISR.Q | Y | Y | 5.28 | 4.14 | 0.5 | 1.3579E7 | |
|
6.8503E6 | 1.7048E7 | 1.6838E7 | 2.49 | 1 | 450 | 463 | |
| R.SVSLTGAPESVQK.A | Y | Y | 5.77 | 3.22 | 0.6 | 1.2008E7 | |
|
6.9974E6 | 1.7072E7 | 1.6224E7 | 2.44 | 1 | 192 | 204 | |
| R.IINDLLQSLR.S | N | Y | 5.18 | 3.85 | 1.8 | 1.0489E7 | |
|
5.0002E6 | 1.2788E7 | 1.3679E7 | 2.74 | 1 | 386 | 395 | |
| R.HSVGVVIGR.S | N | Y | 5.25 | 2.92 | 0.6 | 9.6309E6 | |
|
5.0303E6 | 1.3594E7 | 1.3667E7 | 2.72 | 1 | 333 | 341 | |
| R.VPDGMVGLIIGR.G | N | Y | 5.02 | 4.66 | 0.6 | 5.4227E6 | |
|
2.3024E6 | 7.4663E6 | 6.4994E6 | 3.24 | 1 | 152 | 163 | |
| K.VQQAC(+57.02)EMVMDILR.E | N | Y | 4.99 | 5.65 | 0.5 | 5.2579E6 | |
|
1.7632E6 | 7.3953E6 | 6.6153E6 | 4.19 | 1 | 293 | 305 | Carbamidomethylation |
| K.IGQQPQQPGAPPQQDYTK.A | N | Y | 7.46 | 3.30 | 0.6 | 4.7656E6 | |
|
2.6859E6 | 7.3214E6 | 6.1198E6 | 2.73 | 1 | 630 | 647 | |
| K.QAQVATGGGPGAPPGSQPDYSAAWAEYYR.Q | N | Y | 9.57 | 1.89 | 1.6 | 3.8059E6 | |
|
2.3353E6 | 5.3024E6 | 4.3637E6 | 2.27 | 2 | 656 | 684 | |
| K.KIGQQPQQPGAPPQQDYTK.A | N | Y | 18.13 | 3.10 | 0.8 | 1.3123E6 | |
|
9.3752E5 | 1.7046E6 | 1.7211E6 | 1.84 | 1 | 629 | 647 | |
| total 10 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VQISPDSGGLPER.S | Y | Y | 5.98 | 2.89 | 0.8 | 1.7836E7 | |
|
9.3256E6 | 2.3421E7 | 2.0761E7 | 2.51 | 1 | 179 | 191 | |
| K.AINQQTGAFVEISR.Q | Y | Y | 5.28 | 4.14 | 0.5 | 1.3579E7 | |
|
6.8503E6 | 1.7048E7 | 1.6838E7 | 2.49 | 1 | 450 | 463 | |
| R.SVSLTGAPESVQK.A | Y | Y | 5.77 | 3.22 | 0.6 | 1.2008E7 | |
|
6.9974E6 | 1.7072E7 | 1.6224E7 | 2.44 | 1 | 192 | 204 | |
| R.IINDLLQSLR.S | N | Y | 5.18 | 3.85 | 1.8 | 1.0489E7 | |
|
5.0002E6 | 1.2788E7 | 1.3679E7 | 2.74 | 1 | 386 | 395 | |
| R.HSVGVVIGR.S | N | Y | 5.25 | 2.92 | 0.6 | 9.6309E6 | |
|
5.0303E6 | 1.3594E7 | 1.3667E7 | 2.72 | 1 | 333 | 341 | |
| R.VPDGMVGLIIGR.G | N | Y | 5.02 | 4.66 | 0.6 | 5.4227E6 | |
|
2.3024E6 | 7.4663E6 | 6.4994E6 | 3.24 | 1 | 152 | 163 | |
| K.VQQAC(+57.02)EMVMDILR.E | N | Y | 4.99 | 5.65 | 0.5 | 5.2579E6 | |
|
1.7632E6 | 7.3953E6 | 6.6153E6 | 4.19 | 1 | 293 | 305 | Carbamidomethylation |
| K.IGQQPQQPGAPPQQDYTK.A | N | Y | 7.46 | 3.30 | 0.6 | 4.7656E6 | |
|
2.6859E6 | 7.3214E6 | 6.1198E6 | 2.73 | 1 | 630 | 647 | |
| K.QAQVATGGGPGAPPGSQPDYSAAWAEYYR.Q | N | Y | 9.57 | 1.89 | 1.6 | 3.8059E6 | |
|
2.3353E6 | 5.3024E6 | 4.3637E6 | 2.27 | 2 | 656 | 684 | |
| K.KIGQQPQQPGAPPQQDYTK.A | N | Y | 18.13 | 3.10 | 0.8 | 1.3123E6 | |
|
9.3752E5 | 1.7046E6 | 1.7211E6 | 1.84 | 1 | 629 | 647 | |
| total 10 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.TLTGTVIDSGDGVTHVIPVAEGYVIGSC(+57.02)IK.H | Y | Y | 7.63 | 3.10 | 1.2 | 1.3416E7 |  |
 |
2.3045E7 | 8.9311E6 | 8.273E6 | 2.79 | 1 | 162 | 191 | Carbamidomethylation |
| R.AEPEDHYFLLTEPPLNTPENR.E | Y | Y | 7.46 | 2.53 | 0.9 | 1.2731E7 |  |
 |
1.997E7 | 8.5448E6 | 9.6914E6 | 2.34 | 2 | 103 | 123 | |
| R.LPAC(+57.02)VVDC(+57.02)GTGYTK.L | Y | Y | 7.79 | 1.48 | 0.4 | 1.2345E7 |  |
 |
1.5395E7 | 8.7667E6 | 1.2873E7 | 1.76 | 1 | 5 | 18 | Carbamidomethylation |
| K.NIVLSGGSTMFR.D | N | Y | 5.53 | 0.66 | 1.2 | 5.3909E6 |  |
 |
6.1799E6 | 4.9033E6 | 5.0895E6 | 1.26 | 1 | 318 | 329 | |
| K.LGYAGNTEPQFIIPSC(+57.02)IAIK.E | N | Y | 5.72 | 2.99 | 0.5 | 3.5906E6 |  |
 |
5.8064E6 | 2.4715E6 | 3.1118E6 | 2.35 | 1 | 19 | 38 | Carbamidomethylation |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.TLTGTVIDSGDGVTHVIPVAEGYVIGSC(+57.02)IK.H | Y | Y | 7.63 | 3.10 | 1.2 | 1.3416E7 | |
|
2.3045E7 | 8.9311E6 | 8.273E6 | 2.79 | 1 | 163 | 192 | Carbamidomethylation |
| R.AEPEDHYFLLTEPPLNTPENR.E | Y | Y | 7.46 | 2.53 | 0.9 | 1.2731E7 | |
|
1.997E7 | 8.5448E6 | 9.6914E6 | 2.34 | 2 | 103 | 123 | |
| R.LPAC(+57.02)VVDC(+57.02)GTGYTK.L | Y | Y | 7.79 | 1.48 | 0.4 | 1.2345E7 | |
|
1.5395E7 | 8.7667E6 | 1.2873E7 | 1.76 | 1 | 5 | 18 | Carbamidomethylation |
| K.NIVLSGGSTMFR.D | N | Y | 5.53 | 0.66 | 1.2 | 5.3909E6 | |
|
6.1799E6 | 4.9033E6 | 5.0895E6 | 1.26 | 1 | 319 | 330 | |
| K.LGYAGNTEPQFIIPSC(+57.02)IAIK.E | N | Y | 5.72 | 2.99 | 0.5 | 3.5906E6 | |
|
5.8064E6 | 2.4715E6 | 3.1118E6 | 2.35 | 1 | 19 | 38 | Carbamidomethylation |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ADFPAGIPEC(+57.02)GTDALR.F | Y | Y | 6.99 | 3.29 | 0.5 | 4.5553E6 |  |
|
7.6887E6 | 3.0362E6 | 3.9216E6 | 2.53 | 1 | 908 | 923 | Carbamidomethylation |
| R.GETTLWNPGC(+57.02)DHAGIATQVVVEK.K | Y | Y | 7.42 | 2.49 | 0.7 | 4.2661E6 |  |
 |
6.4625E6 | 2.7253E6 | 3.6105E6 | 2.37 | 1 | 372 | 394 | Carbamidomethylation |
| K.VQGSDSDEEVVVATTR.I | Y | Y | 8.08 | 3.66 | 0.8 | 3.6772E6 |  |
 |
6.3154E6 | 2.1454E6 | 2.5707E6 | 2.94 | 1 | 522 | 537 | |
| R.IETMLGDVAVAVHPK.D | N | Y | 5.67 | 3.35 | 1.2 | 2.3787E6 |  |
 |
3.4206E6 | 1.5228E6 | 2.1927E6 | 2.25 | 1 | 538 | 552 | |
| R.DPGVITYDLPTPPGEK.K | N | Y | 6.52 | 3.95 | 0.6 | 2.179E6 |  |
 |
3.3687E6 | 1.2838E6 | 1.8846E6 | 2.62 | 1 | 274 | 289 | |
| R.EVYLHAIVR.D | N | Y | 4.25 | 1.61 | 6.5 | 1.4849E6 |  |
 |
8.9676E5 | 1.8353E6 | 1.7226E6 | 2.05 | 1 | 848 | 856 | |
| K.ITPAHDQNDYEVGQR.H | N | Y | 8.02 | 6.43 | 1.3 | 7.783E4 |  |
 |
1.8555E5 | 3.1606E4 | 4.0039E4 | 5.87 | 1 | 592 | 606 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VWDISTVSSVNEAFGR.R | Y | Y | 4.20 | 2.88 | 2.9 | 1.6198E6 | |
|
6.7835E5 | 1.9809E6 | 2.2002E6 | 3.24 | 1 | 456 | 471 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LHISPSNMTNQNTNEYLEK.I | Y | Y | 6.38 | 3.01 | 0.6 | 4.9396E6 |  |
 |
2.601E6 | 5.8855E6 | 6.3323E6 | 2.43 | 1 | 343 | 361 | |
| R.DGIDDESYEAIFKPVMSK.V | Y | Y | 6.77 | 4.65 | 0.5 | 2.6674E6 |  |
 |
1.0719E6 | 3.2475E6 | 3.6829E6 | 3.44 | 1 | 230 | 247 | |
| K.VMEMFQPSAVVLQC(+57.02)GSDSLSGDR.L | Y | Y | 4.46 | 7.90 | 1.7 | 6.7482E5 |  |
 |
8.18E4 | 9.4257E5 | 1.0205E6 | 12.48 | 1 | 248 | 270 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LHISPSNMTNQNTNEYLEK.I | Y | Y | 6.38 | 3.01 | 0.6 | 4.9396E6 | |
|
2.601E6 | 5.8855E6 | 6.3323E6 | 2.43 | 1 | 343 | 361 | |
| R.DGIDDESYEAIFKPVMSK.V | Y | Y | 6.77 | 4.65 | 0.5 | 2.6674E6 | |
|
1.0719E6 | 3.2475E6 | 3.6829E6 | 3.44 | 1 | 230 | 247 | |
| K.VMEMFQPSAVVLQC(+57.02)GSDSLSGDR.L | Y | Y | 4.46 | 7.90 | 1.7 | 6.7482E5 | |
|
8.18E4 | 9.4257E5 | 1.0205E6 | 12.48 | 1 | 248 | 270 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AC(+57.02)LISLGYDIGNDPQGEAEFAR.I | Y | Y | 6.65 | 5.08 | 1.0 | 4.1607E6 | |
|
8.0242E6 | 2.3382E6 | 2.1197E6 | 3.79 | 2 | 773 | 794 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SFEAPATINSASLHPEK.E | Y | Y | 8.94 | 2.05 | 1.2 | 1.2166E7 |  |
 |
8.2242E6 | 1.3124E7 | 1.5151E7 | 1.84 | 2 | 219 | 235 | |
| R.FSPDGELYASGSEDGTLR.L | Y | Y | 5.27 | 4.82 | 1.4 | 9.3163E6 |  |
 |
3.3007E6 | 1.1328E7 | 1.332E7 | 4.04 | 1 | 273 | 290 | |
| R.IYDLNKPEAEPK.E | Y | Y | 10.89 | 3.16 | 0.8 | 8.5965E6 |  |
 |
4.5813E6 | 1.0599E7 | 1.3259E7 | 2.89 | 2 | 126 | 137 | |
| K.TVDFTQDSNYLLTGGQDK.L | N | Y | 5.76 | 5.48 | 0.7 | 7.4128E6 |  |
 |
3.2782E6 | 9.3168E6 | 9.6433E6 | 2.94 | 1 | 105 | 122 | |
| K.AATAAADFTAK.V | N | Y | 3.69 | 1.88 | 3.8 | 6.3114E6 |  |
 |
4.0609E6 | 8.8808E6 | 8.2126E6 | 2.19 | 1 | 74 | 84 | |
| K.VWDAVSGDELMTLAHK.H | N | Y | 5.93 | 3.40 | 0.5 | 5.9681E6 |  |
 |
2.4676E6 | 6.9677E6 | 8.4689E6 | 3.43 | 1 | 85 | 100 | |
| K.YDYNSGEELESYK.G | N | Y | 6.10 | 5.09 | 0.4 | 5.4603E6 |  |
 |
1.8859E6 | 7.0443E6 | 7.4507E6 | 3.95 | 1 | 250 | 262 | |
| K.GHFGPIHC(+57.02)VR.F | N | Y | 3.93 | 1.71 | 1.1 | 2.115E6 |  |
 |
1.4002E6 | 1.8784E6 | 3.5359E6 | 2.53 | 1 | 263 | 272 | Carbamidomethylation |
| total 8 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SFEAPATINSASLHPEK.E | Y | Y | 8.94 | 2.05 | 1.2 | 1.2166E7 | |
|
8.2242E6 | 1.3124E7 | 1.5151E7 | 1.84 | 2 | 219 | 235 | |
| R.FSPDGELYASGSEDGTLR.L | Y | Y | 5.27 | 4.82 | 1.4 | 9.3163E6 | |
|
3.3007E6 | 1.1328E7 | 1.332E7 | 4.04 | 1 | 273 | 290 | |
| R.IYDLNKPEAEPK.E | Y | Y | 10.89 | 3.16 | 0.8 | 8.5965E6 | |
|
4.5813E6 | 1.0599E7 | 1.3259E7 | 2.89 | 2 | 126 | 137 | |
| K.TVDFTQDSNYLLTGGQDK.L | N | Y | 5.76 | 5.48 | 0.7 | 7.4128E6 | |
|
3.2782E6 | 9.3168E6 | 9.6433E6 | 2.94 | 1 | 105 | 122 | |
| K.AATAAADFTAK.V | N | Y | 3.69 | 1.88 | 3.8 | 6.3114E6 | |
|
4.0609E6 | 8.8808E6 | 8.2126E6 | 2.19 | 1 | 74 | 84 | |
| K.VWDAVSGDELMTLAHK.H | N | Y | 5.93 | 3.40 | 0.5 | 5.9681E6 | |
|
2.4676E6 | 6.9677E6 | 8.4689E6 | 3.43 | 1 | 85 | 100 | |
| K.YDYNSGEELESYK.G | N | Y | 6.10 | 5.09 | 0.4 | 5.4603E6 | |
|
1.8859E6 | 7.0443E6 | 7.4507E6 | 3.95 | 1 | 250 | 262 | |
| K.GHFGPIHC(+57.02)VR.F | N | Y | 3.93 | 1.71 | 1.1 | 2.115E6 | |
|
1.4002E6 | 1.8784E6 | 3.5359E6 | 2.53 | 1 | 263 | 272 | Carbamidomethylation |
| total 8 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LLEQYKEESK.K | Y | Y | 4.07 | 2.33 | 0.6 | 1.2889E7 | |
|
7.8591E6 | 1.3775E7 | 2.1192E7 | 2.70 | 2 | 639 | 648 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LLEQYKEESK.K | Y | Y | 4.07 | 2.33 | 0.6 | 1.2889E7 | |
|
7.8591E6 | 1.3775E7 | 2.1192E7 | 2.70 | 2 | 639 | 648 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AGYPQYVSEILEK.I | Y | Y | 5.36 | 5.68 | 0.5 | 9.5769E6 |  |
 |
3.9785E6 | 1.1475E7 | 1.3277E7 | 3.34 | 1 | 320 | 332 | |
| K.LDDLFLK.R | Y | Y | 4.35 | 2.53 | 0.6 | 6.718E6 |  |
 |
4.3985E6 | 5.2275E6 | 1.0528E7 | 2.39 | 1 | 1355 | 1361 | |
| R.FSPTDFLAK.M | Y | Y | 5.35 | 3.12 | 0.7 | 4.008E6 |  |
 |
2.3071E6 | 5.1207E6 | 4.5963E6 | 2.22 | 1 | 178 | 186 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VAQLEQVYIR.G | Y | Y | 5.86 | 3.90 | 0.7 | 2.9689E7 |  |
 |
1.4878E7 | 3.5397E7 | 3.8793E7 | 2.61 | 1 | 55 | 64 | |
| K.VLHEAEGHIVTC(+57.02)ETNTGEVYR.G | Y | Y | 12.94 | 1.91 | 1.1 | 2.3689E7 |  |
 |
1.658E7 | 2.446E7 | 3.018E7 | 1.82 | 3 | 9 | 29 | Carbamidomethylation |
| K.LIEAEDNMNC(+57.02)QMSNITVTYR.D | Y | Y | 4.47 | 3.39 | 0.9 | 2.5941E6 |  |
 |
9.1213E5 | 3.2162E6 | 3.6541E6 | 4.01 | 1 | 32 | 51 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VAQLEQVYIR.G | Y | Y | 5.86 | 3.90 | 0.7 | 2.9689E7 | |
|
1.4878E7 | 3.5397E7 | 3.8793E7 | 2.61 | 1 | 55 | 64 | |
| K.VLHEAEGHIVTC(+57.02)ETNTGEVYR.G | Y | Y | 12.94 | 1.91 | 1.1 | 2.3689E7 | |
|
1.658E7 | 2.446E7 | 3.018E7 | 1.82 | 3 | 9 | 29 | Carbamidomethylation |
| K.LIEAEDNMNC(+57.02)QMSNITVTYR.D | Y | Y | 4.47 | 3.39 | 0.9 | 2.5941E6 | |
|
9.1213E5 | 3.2162E6 | 3.6541E6 | 4.01 | 1 | 32 | 51 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VAQLEQVYIR.G | Y | Y | 5.86 | 3.90 | 0.7 | 2.9689E7 | |
|
1.4878E7 | 3.5397E7 | 3.8793E7 | 2.61 | 1 | 55 | 64 | |
| K.VLHEAEGHIVTC(+57.02)ETNTGEVYR.G | Y | Y | 12.94 | 1.91 | 1.1 | 2.3689E7 | |
|
1.658E7 | 2.446E7 | 3.018E7 | 1.82 | 3 | 9 | 29 | Carbamidomethylation |
| K.LIEAEDNMNC(+57.02)QMSNITVTYR.D | Y | Y | 4.47 | 3.39 | 0.9 | 2.5941E6 | |
|
9.1213E5 | 3.2162E6 | 3.6541E6 | 4.01 | 1 | 32 | 51 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SQGKPIELTPLPLLK.D | Y | Y | 5.62 | 5.16 | 0.6 | 7.7665E5 | |
|
1.2562E6 | 3.8464E5 | 6.8913E5 | 3.27 | 1 | 38 | 52 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SQGKPIELTPLPLLK.D | Y | Y | 5.62 | 5.16 | 0.6 | 7.7665E5 | |
|
1.2562E6 | 3.8464E5 | 6.8913E5 | 3.27 | 1 | 38 | 52 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SQGKPIELTPLPLLK.D | Y | Y | 5.62 | 5.16 | 0.6 | 7.7665E5 | |
|
1.2562E6 | 3.8464E5 | 6.8913E5 | 3.27 | 1 | 38 | 52 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SQGKPIELTPLPLLK.D | Y | Y | 5.62 | 5.16 | 0.6 | 7.7665E5 | |
|
1.2562E6 | 3.8464E5 | 6.8913E5 | 3.27 | 1 | 38 | 52 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.GLSSLLYGSIPK.A | Y | Y | 4.63 | 3.03 | 5.0 | 4.669E6 | |
|
7.6578E6 | 2.5211E6 | 3.8282E6 | 3.04 | 1 | 86 | 97 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.GLSSLLYGSIPK.A | Y | Y | 4.63 | 3.03 | 5.0 | 4.669E6 | |
|
7.6578E6 | 2.5211E6 | 3.8282E6 | 3.04 | 1 | 86 | 97 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VSVGEFVGEGEGK.S | Y | Y | 3.28 | 3.24 | 2.8 | 1.7014E6 |  |
 |
5.3887E5 | 3.5461E6 | 2.0406E6 | 6.58 | 1 | 138 | 150 | |
| K.SEISQVFEIALK.R | Y | Y | 4.86 | 5.54 | 0.7 | 1.2234E6 |  |
 |
4.6147E5 | 1.8878E6 | 1.3209E6 | 4.09 | 1 | 96 | 107 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.DNVC(+57.02)SPGGATIHALHFLESGGFR.S | Y | Y | 6.73 | 2.68 | 0.8 | 4.1412E6 | |
|
2.5703E6 | 3.877E6 | 6.3638E6 | 2.48 | 2 | 229 | 251 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.DTLVQGLNEAGDDLEAVAK.F | Y | Y | 4.85 | 4.12 | 1.5 | 3.3107E6 | |
|
1.4992E6 | 3.838E6 | 4.5948E6 | 3.06 | 1 | 32 | 50 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.DTLVQGLNEAGDDLEAVAK.F | Y | Y | 4.85 | 4.12 | 1.5 | 3.3107E6 | |
|
1.4992E6 | 3.838E6 | 4.5948E6 | 3.06 | 1 | 41 | 59 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LPANHPLLTGQR.V | Y | Y | 5.13 | 3.58 | 0.4 | 6.2724E6 |  |
 |
1.1528E7 | 3.4904E6 | 4.6711E6 | 3.30 | 1 | 251 | 262 | |
| R.VGHSELVGEIIR.L | Y | Y | 6.66 | 3.76 | 0.6 | 6.5199E6 |  |
 |
1.1162E7 | 3.8677E6 | 4.5296E6 | 2.89 | 2 | 75 | 86 | |
| R.LAEMPADSGYPAYLGAR.L | Y | Y | 6.83 | 2.54 | 0.8 | 3.9423E6 |  |
 |
5.9173E6 | 2.6449E6 | 3.2649E6 | 2.24 | 1 | 395 | 411 | |
| K.YSNSDVIIYVGC(+57.02)GER.G | N | Y | 7.30 | 2.94 | 1.0 | 1.2185E6 |  |
 |
2.0275E6 | 8.5055E5 | 7.7739E5 | 2.61 | 1 | 296 | 310 | Carbamidomethylation |
| R.DFPELTMEVDGK.V | N | Y | 5.84 | 3.20 | 0.6 | 1.1871E6 |  |
 |
1.7986E6 | 7.9489E5 | 9.6777E5 | 2.26 | 1 | 320 | 331 | |
| K.ASLAETDKITLEVAK.L | N | Y | 12.45 | 5.67 | 0.7 | 5.4771E5 |  |
 |
1.131E6 | 2.3367E5 | 3.3685E5 | 4.84 | 1 | 529 | 543 | |
| R.LEGDMATIQVYEETSGVSVGDPVLR.T | N | Y | 9.61 | 2.24 | 1.5 | 5.1633E5 |  |
 |
8.0108E5 | 3.504E5 | 3.9753E5 | 2.29 | 1 | 87 | 111 | |
| R.DMGYHVSMMADSTSR.W | N | Y | 12.82 | 2.15 | 2.2 | 2.2396E5 |  |
 |
2.7284E5 | 1.3549E5 | 2.6355E5 | 2.01 | 1 | 369 | 383 | |
| total 8 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IVEDAPPIDLQAEAQHASGEVEEPPR.Y | Y | Y | 12.46 | 2.19 | 1.5 | 3.3459E6 |  |
 |
1.9698E6 | 4.1467E6 | 3.9211E6 | 2.11 | 1 | 58 | 83 | |
| K.GEIGDATPFNDAVNVQK.I | Y | Y | 6.43 | 6.75 | 1.8 | 1.17E6 |  |
 |
4.3138E5 | 1.665E6 | 1.4137E6 | 3.86 | 1 | 994 | 1010 | |
| K.TVTLPENEDELESTNR.R | Y | Y | 9.59 | 3.66 | 0.9 | 6.3359E5 |  |
 |
2.1963E5 | 8.5473E5 | 8.264E5 | 3.89 | 1 | 870 | 885 | |
| K.ISNLLSDYGYHLR.G | N | Y | 8.56 | 2.49 | 2.1 | 5.7924E5 |  |
 |
3.5425E5 | 6.568E5 | 9.6888E5 | 2.73 | 1 | 1011 | 1023 | |
| K.QEVPIIIVFR.A | N | Y | 4.35 | 2.53 | 3.8 | 4.7749E5 |  |
 |
2.6041E5 | 6.2476E5 | 5.473E5 | 2.40 | 1 | 265 | 274 | |
| R.TSETGIVDQVMVTLNQEGYK.F | N | Y | 5.27 | 5.63 | 1.1 | 2.8281E5 |  |
 |
1.1006E5 | 6.0599E5 | 4.5187E5 | 5.51 | 1 | 898 | 917 | |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.AVAGDASESALLK.C | Y | Y | 4.77 | 2.68 | 0.6 | 2.0683E7 |  |
 |
3.0389E7 | 1.6238E7 | 1.5423E7 | 1.97 | 1 | 446 | 458 | |
| R.SPDFTNENPLETR.N | Y | Y | 6.55 | 3.82 | 0.5 | 1.6726E7 |  |
 |
2.8384E7 | 1.1347E7 | 1.0447E7 | 2.72 | 1 | 228 | 240 | |
| R.NIAFFSTNC(+57.02)VEGTAR.G | Y | Y | 5.38 | 5.53 | 0.6 | 7.7724E6 |  |
 |
1.2472E7 | 4.9289E6 | 5.9164E6 | 2.53 | 1 | 241 | 255 | Carbamidomethylation |
| K.YGTDLSR.G | N | Y | 4.66 | 4.00 | 0.5 | 4.2898E6 |  |
 |
7.5812E6 | 3.2522E6 | 2.849E6 | 2.66 | 1 | 55 | 61 | |
| K.LSLDELHR.K | N | Y | 5.33 | 4.00 | 0.5 | 3.3165E6 |  |
 |
5.2075E6 | 2.4773E6 | 2.2646E6 | 2.30 | 1 | 46 | 53 | |
| R.WINDVEDSYGQQWTYEQR.K | N | Y | 7.37 | 1.78 | 0.5 | 3.0346E6 |  |
 |
4.3707E6 | 2.4493E6 | 2.2839E6 | 1.91 | 1 | 894 | 911 | |
| R.YHTEIVFAR.T | N | Y | 6.14 | 1.91 | 1.8 | 5.5051E6 |  |
 |
7.506E6 | 4.6454E6 | 4.364E6 | 1.72 | 2 | 684 | 692 | |
| K.DAFQNAYLELGGLGER.V | N | Y | 5.08 | 3.22 | 0.6 | 1.2625E6 |  |
 |
1.3282E6 | 1.7419E6 | 7.1743E5 | 2.43 | 1 | 536 | 551 | |
| total 8 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LLSDATVEKDESHAGK.V | Y | Y | 10.35 | 3.66 | 0.7 | 1.2215E6 | |
|
7.0515E5 | 1.0885E6 | 2.1429E6 | 3.04 | 1 | 290 | 305 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VLLDAPC(+57.02)SGTGVISK.D | Y | Y | 4.69 | 4.59 | 0.5 | 3.627E6 |  |
 |
1.0301E6 | 4.7389E6 | 5.1119E6 | 4.96 | 1 | 441 | 455 | Carbamidomethylation |
| K.NTGVILANDANAER.L | Y | Y | 5.10 | 3.24 | 5.6 | 2.4192E6 |  |
 |
1.487E6 | 3.3658E6 | 3.2462E6 | 2.26 | 1 | 392 | 405 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.MALDGQNIYNAC(+57.02)C(+57.02)TLR.I | Y | Y | 5.65 | 5.74 | 2.1 | 1.4345E6 | |
|
2.145E6 | 1.5325E6 | 6.2612E5 | 3.43 | 1 | 208 | 223 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.MALDGQNIYNAC(+57.02)C(+57.02)TLR.I | Y | Y | 5.65 | 5.74 | 2.1 | 1.4345E6 | |
|
2.145E6 | 1.5325E6 | 6.2612E5 | 3.43 | 1 | 205 | 220 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.MALDGQNIYNAC(+57.02)C(+57.02)TLR.I | Y | Y | 5.65 | 5.74 | 2.1 | 1.4345E6 | |
|
2.145E6 | 1.5325E6 | 6.2612E5 | 3.43 | 1 | 226 | 241 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.TALALEVGDIVK.V | Y | Y | 4.87 | 13.18 | 0.6 | 1.7973E7 |  |
 |
3.7934E6 | 2.0511E7 | 2.9615E7 | 7.81 | 1 | 254 | 265 | |
| R.TLYDFPGNDAEDLPFK.K | Y | Y | 5.19 | 1.46 | 0.9 | 2.7064E6 |  |
 |
2.2342E6 | 2.6568E6 | 3.2281E6 | 1.44 | 1 | 130 | 145 | |
| R.SAWYMGPVSR.Q | Y | Y | 3.99 | 1.50 | 2.0 | 1.7865E6 |  |
 |
1.8299E6 | 1.2216E6 | 2.308E6 | 1.89 | 1 | 12 | 21 | |
| R.DSSTC(+57.02)PGDYVLSVSENSR.V | N | Y | 6.32 | 3.89 | 3.0 | 1.2847E6 |  |
 |
8.0225E5 | 1.0159E6 | 2.2899E6 | 2.85 | 1 | 40 | 57 | Carbamidomethylation |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LSVEGFAVDK.M | Y | Y | 4.77 | 15.40 | 0.6 | 1.8005E7 |  |
 |
2.8928E6 | 1.809E7 | 3.3031E7 | 11.42 | 1 | 855 | 864 | |
| R.LGLQNDLFSLAR.A | Y | Y | 5.74 | 1.65 | 1.2 | 1.1183E7 |  |
 |
9.3215E6 | 9.9734E6 | 1.4253E7 | 1.53 | 1 | 617 | 628 | |
| R.AGIISTVEVLK.V | N | Y | 5.00 | 0.40 | 0.7 | 5.0148E6 |  |
 |
4.7905E6 | 4.6685E6 | 5.5855E6 | 1.20 | 1 | 629 | 639 | |
| K.VTLSFPSTLQTGTGTLK.I | N | Y | 6.46 | 0.56 | 0.5 | 4.9561E6 |  |
 |
4.8692E6 | 4.5056E6 | 5.4934E6 | 1.22 | 1 | 130 | 146 | |
| R.AQELDALDNSHPIEVSVGHPSEVDEIFDAISYSK.G | N | Y | 7.37 | 1.14 | 0.6 | 4.5321E6 |  |
 |
5.7128E6 | 3.7356E6 | 4.1479E6 | 1.53 | 1 | 408 | 441 | |
| R.YAAVTQFEATDAR.R | N | Y | 5.68 | 2.18 | 0.3 | 3.9862E6 |  |
 |
2.95E6 | 3.7645E6 | 5.244E6 | 1.78 | 1 | 174 | 186 | |
| R.SPVYLTVLK.H | N | Y | 5.21 | 1.30 | 0.5 | 3.6141E6 |  |
 |
3.4213E6 | 2.9578E6 | 4.4632E6 | 1.51 | 1 | 746 | 754 | |
| K.LNLGTVGFYR.T | N | Y | 4.51 | 1.71 | 0.6 | 3.3229E6 |  |
 |
2.1455E6 | 3.7508E6 | 4.0725E6 | 1.90 | 1 | 582 | 591 | |
| R.KPYPDDENLVEVK.F | Y | Y | 6.35 | 1.97 | 4.2 | 5.5338E6 |  |
 |
3.688E6 | 5.609E6 | 8.0189E6 | 2.17 | 2 | 223 | 235 | |
| R.DLSLPPVDR.L | N | Y | 4.14 | 1.68 | 4.1 | 3.2135E6 |  |
 |
1.8881E6 | 3.8088E6 | 3.9436E6 | 2.09 | 1 | 608 | 616 | |
| K.LEAAAQVR.Q | N | Y | 4.24 | 1.65 | 0.5 | 2.8649E6 |  |
 |
1.8975E6 | 3.3503E6 | 4.1845E6 | 2.21 | 1 | 81 | 88 | |
| K.VLTFALSEEVRPQDTVSVIGGVAGGSK.H | N | Y | 6.33 | 0.54 | 0.7 | 2.7713E6 |  |
 |
3.2356E6 | 2.5172E6 | 2.5612E6 | 1.29 | 1 | 796 | 822 | |
| R.VALSNMNVIDR.K | N | Y | 6.39 | 0.59 | 0.5 | 2.5136E6 |  |
 |
2.7046E6 | 2.1769E6 | 2.6594E6 | 1.24 | 1 | 212 | 222 | |
| R.LGWDPKPGEGHLDALLR.G | N | Y | 8.77 | 1.22 | 0.6 | 2.8955E6 |  |
 |
2.9059E6 | 2.2701E6 | 3.5106E6 | 1.55 | 2 | 691 | 707 | |
| K.DYFNVPYPLPK.I | N | Y | 5.36 | 7.48 | 0.6 | 8.5375E5 |  |
|
3.3497E5 | 1.2998E6 | 9.2651E5 | 3.88 | 1 | 295 | 305 | |
| K.AFFESHPAPSAER.T | N | Y | 12.56 | 2.30 | 1.5 | 3.8635E5 |  |
 |
4.8731E5 | 2.3659E5 | 4.3516E5 | 2.06 | 1 | 871 | 883 | |
| total 16 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IVPEWQDYDQEIK.Q | Y | Y | 6.63 | 5.17 | 0.7 | 2.4735E6 |  |
 |
4.4744E6 | 1.2687E6 | 1.6774E6 | 3.53 | 1 | 1509 | 1521 | |
| K.EQLDPDELETITMHK.I | Y | Y | 7.67 | 1.86 | 0.7 | 1.1177E6 |  |
 |
1.5604E6 | 7.6426E5 | 1.0285E6 | 2.04 | 1 | 644 | 658 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IVPEWQDYDQEIK.Q | Y | Y | 6.63 | 5.17 | 0.7 | 2.4735E6 | |
|
4.4744E6 | 1.2687E6 | 1.6774E6 | 3.53 | 1 | 1501 | 1513 | |
| K.EQLDPDELETITMHK.I | Y | Y | 7.67 | 1.86 | 0.7 | 1.1177E6 | |
|
1.5604E6 | 7.6426E5 | 1.0285E6 | 2.04 | 1 | 644 | 658 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.KVEEAEPEEFVVEK.V | Y | Y | 6.26 | 9.82 | 0.6 | 1.6134E7 |  |
 |
7.3163E6 | 2.0573E7 | 2.0514E7 | 2.81 | 2 | 21 | 34 | |
| R.LTWHSC(+57.02)PEDEAQ | Y | Y | 6.94 | 4.24 | 0.5 | 9.3797E6 |  |
 |
4.3947E6 | 1.0767E7 | 1.2977E7 | 2.95 | 1 | 172 | 183 | Carbamidomethylation |
| K.WKDSDEADLVLAK.E | Y | Y | 6.31 | 1.37 | 0.9 | 1.2375E7 |  |
 |
9.4991E6 | 1.2419E7 | 1.5207E7 | 1.60 | 2 | 142 | 154 | |
| K.VEEAEPEEFVVEK.V | N | Y | 6.56 | 3.50 | 0.6 | 2.563E6 |  |
|
1.1582E6 | 3.1889E6 | 3.342E6 | 2.89 | 1 | 22 | 34 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SYLTEQVNQDLPK.E | Y | Y | 8.45 | 7.07 | 0.8 | 2.1428E6 | |
|
4.389E6 | 1.0122E6 | 1.0272E6 | 4.34 | 1 | 639 | 651 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SYLTEQVNQDLPK.E | Y | Y | 8.45 | 7.07 | 0.8 | 2.1428E6 | |
|
4.389E6 | 1.0122E6 | 1.0272E6 | 4.34 | 1 | 617 | 629 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LLQC(+57.02)YPPPEDAAVK.G | Y | Y | 6.93 | 6.80 | 1.2 | 1.8379E6 |  |
 |
3.6544E6 | 7.849E5 | 1.0745E6 | 4.66 | 1 | 264 | 277 | Carbamidomethylation |
| K.THIDTVINALK.T | Y | Y | 4.73 | 1.92 | 2.9 | 1.7261E6 |  |
 |
2.4016E6 | 1.2494E6 | 1.5272E6 | 1.92 | 1 | 368 | 378 | |
| K.FINLFPETK.A | Y | Y | 8.24 | 3.79 | 0.7 | 9.2853E5 |  |
 |
1.549E6 | 5.4536E5 | 6.9121E5 | 2.84 | 1 | 548 | 556 | |
| K.FFQPTEMAAQDFFQR.W | N | Y | 6.35 | 1.44 | 2.1 | 6.3098E5 |  |
 |
8.1369E5 | 6.2017E5 | 4.5909E5 | 1.77 | 1 | 843 | 857 | |
| R.VAAQVDGGAQVQQVLNIEC(+57.02)LR.D | N | Y | 12.43 | 3.98 | 1.5 | 6.1627E5 |  |
 |
1.108E6 | 3.433E5 | 3.9748E5 | 3.23 | 1 | 791 | 811 | Carbamidomethylation |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LLQC(+57.02)YPPPEDAAVK.G | Y | Y | 6.93 | 6.80 | 1.2 | 1.8379E6 | |
|
3.6544E6 | 7.849E5 | 1.0745E6 | 4.66 | 1 | 299 | 312 | Carbamidomethylation |
| K.THIDTVINALK.T | Y | Y | 4.73 | 1.92 | 2.9 | 1.7261E6 | |
|
2.4016E6 | 1.2494E6 | 1.5272E6 | 1.92 | 1 | 403 | 413 | |
| K.FINLFPETK.A | Y | Y | 8.24 | 3.79 | 0.7 | 9.2853E5 | |
|
1.549E6 | 5.4536E5 | 6.9121E5 | 2.84 | 1 | 583 | 591 | |
| K.FFQPTEMAAQDFFQR.W | N | Y | 6.35 | 1.44 | 2.1 | 6.3098E5 | |
|
8.1369E5 | 6.2017E5 | 4.5909E5 | 1.77 | 1 | 904 | 918 | |
| R.VAAQVDGGAQVQQVLNIEC(+57.02)LR.D | N | Y | 12.43 | 3.98 | 1.5 | 6.1627E5 | |
|
1.108E6 | 3.433E5 | 3.9748E5 | 3.23 | 1 | 852 | 872 | Carbamidomethylation |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SPLQSVVVR.R | Y | Y | 5.66 | 3.68 | 0.5 | 4.3224E6 |  |
 |
2.2582E6 | 5.7617E6 | 4.9473E6 | 2.55 | 1 | 253 | 261 | |
| R.SIFQHIQSAQSQR.S | Y | Y | 5.76 | 10.22 | 3.0 | 5.067E6 |  |
 |
1.6838E6 | 7.5661E6 | 7.8426E6 | 4.66 | 2 | 606 | 618 | |
| K.DSRPSQAAGDNQGDEAK.E | Y | Y | 10.92 | 4.51 | 2.3 | 8.6446E3 |  |
 |
1.8759E4 | 4.9531E3 | 4.6127E3 | 4.07 | 1 | 186 | 202 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LTNENMEITSALQSEQHVK.K | Y | Y | 18.59 | 4.65 | 1.0 | 8.5334E5 | |
|
1.3148E6 | 5.4053E5 | 7.0469E5 | 2.43 | 1 | 586 | 604 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LTNENMEITSALQSEQHVK.K | Y | Y | 18.59 | 4.65 | 1.0 | 8.5334E5 | |
|
1.3148E6 | 5.4053E5 | 7.0469E5 | 2.43 | 1 | 556 | 574 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SIAFPSIGSGR.N | Y | Y | 5.50 | 4.80 | 0.8 | 6.1289E6 |  |
 |
2.4352E6 | 8.5009E6 | 7.4506E6 | 3.49 | 1 | 304 | 314 | |
| K.QTAAQLILK.A | Y | Y | 4.33 | 3.23 | 3.2 | 1.0146E6 |  |
 |
5.8665E5 | 1.7508E6 | 9.4162E5 | 2.98 | 1 | 320 | 328 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SIAFPSIGSGR.N | Y | Y | 5.50 | 4.80 | 0.8 | 6.1289E6 | |
|
2.4352E6 | 8.5009E6 | 7.4506E6 | 3.49 | 1 | 305 | 315 | |
| K.QTAAQLILK.A | Y | Y | 4.33 | 3.23 | 3.2 | 1.0146E6 | |
|
5.8665E5 | 1.7508E6 | 9.4162E5 | 2.98 | 1 | 321 | 329 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.TLDPDPAIR.R | Y | Y | 4.77 | 3.92 | 2.3 | 1.4629E7 |  |
 |
8.493E6 | 1.2545E7 | 2.2851E7 | 2.69 | 1 | 18 | 26 | |
| K.NLFEDQNTLTSIC(+57.02)EK.V | Y | Y | 5.87 | 3.99 | 0.7 | 1.049E7 |  |
 |
4.3161E6 | 1.2007E7 | 1.5148E7 | 3.51 | 1 | 332 | 346 | Carbamidomethylation |
| K.SQIC(+57.02)DNAALYAQK.Y | Y | Y | 6.98 | 2.48 | 0.6 | 9.8585E6 |  |
 |
5.888E6 | 1.0895E7 | 1.2793E7 | 2.17 | 1 | 269 | 281 | Carbamidomethylation |
| K.IIIPEIQK.V | N | Y | 3.90 | 2.20 | 0.5 | 9.6064E6 |  |
 |
7.6393E6 | 1.5739E7 | 1.7747E7 | 2.32 | 1 | 825 | 832 | |
| K.ANIVHLMLSSPEQIQK.Q | N | Y | 8.98 | 1.21 | 0.8 | 9.481E6 |  |
 |
7.032E6 | 1.06E7 | 1.0811E7 | 1.54 | 2 | 94 | 109 | |
| R.AADEEAFEDNSEEYIR.R | N | Y | 7.21 | 3.24 | 0.6 | 8.6834E6 |  |
 |
4.5873E6 | 9.8561E6 | 1.1607E7 | 2.53 | 1 | 356 | 371 | |
| K.VC(+57.02)ASVTFK.N | N | Y | 4.20 | 2.80 | 0.5 | 6.5268E6 |  |
 |
3.4424E6 | 7.476E6 | 1.0531E7 | 3.06 | 1 | 60 | 67 | Carbamidomethylation |
| K.VIVPNMEFR.A | N | Y | 4.47 | 4.60 | 0.6 | 6.4113E6 |  |
 |
1.9204E6 | 7.1283E6 | 1.0185E7 | 5.30 | 1 | 347 | 355 | |
| K.DAAIYLVTSLASK.A | N | Y | 4.35 | 3.21 | 0.9 | 2.8795E6 |  |
 |
1.5588E6 | 4.4088E6 | 2.671E6 | 2.83 | 1 | 428 | 440 | |
| R.IVEDEPNKIC(+57.02)EADR.V | N | Y | 18.21 | 5.54 | 3.0 | 2.4142E5 |  |
 |
1.8198E5 | 1.6126E5 | 4.2133E5 | 2.61 | 1 | 76 | 89 | Carbamidomethylation |
| total 10 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.QYYTLLNQAPDMLHR.F | Y | Y | 7.93 | 2.35 | 1.9 | 8.7377E6 |  |
 |
5.1351E6 | 9.2896E6 | 1.1788E7 | 2.30 | 2 | 18 | 32 | |
| R.HPDSHQLFIGNLPHEVDK.S | Y | Y | 5.99 | 1.88 | 0.3 | 6.3535E6 |  |
 |
4.3796E6 | 7.869E6 | 6.8119E6 | 1.80 | 1 | 334 | 351 | |
| K.FYVHNDIFR.Y | Y | Y | 4.29 | 10.76 | 0.8 | 4.0776E6 |  |
 |
5.6772E5 | 4.6387E6 | 7.0264E6 | 12.38 | 1 | 124 | 132 | |
| R.FMQTFVLAPEGSVANK.F | N | Y | 3.84 | 1.59 | 2.1 | 2.7125E6 |  |
 |
1.7619E6 | 1.848E6 | 4.5277E6 | 2.57 | 1 | 108 | 123 | |
| R.HVDAHATLNDGVVVQVMGLLSNNNQALR.R | N | Y | 6.49 | 0.77 | 2.6 | 2.2027E6 |  |
 |
2.2624E6 | 2.8725E6 | 2.2222E6 | 1.29 | 2 | 79 | 106 | |
| K.SELKDFFQSYGNVVELR.I | N | Y | 6.11 | 4.33 | 8.7 | 4.7942E5 |  |
 |
6.9969E5 | 2.068E5 | 5.3179E5 | 3.38 | 1 | 352 | 368 | |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NAAGALDLLK.E | Y | Y | 4.56 | 2.50 | 0.5 | 2.6827E6 |  |
 |
1.401E6 | 3.1712E6 | 3.4759E6 | 2.48 | 1 | 20 | 29 | |
| K.TGGTQTDLFTC(+57.02)GK.C | Y | Y | 5.42 | 2.65 | 0.5 | 2.3602E6 |  |
 |
1.1106E6 | 2.8371E6 | 3.133E6 | 2.82 | 1 | 253 | 265 | Carbamidomethylation |
| R.SADEPMTTFVVC(+57.02)NEC(+57.02)GNR.W | Y | Y | 14.23 | 8.29 | 1.0 | 7.1143E5 |  |
 |
2.0623E5 | 8.1768E5 | 1.1104E6 | 5.38 | 1 | 280 | 297 | Carbamidomethylation |
| R.KQSTDEEVTSLAK.S | N | Y | 5.66 | 1.73 | 2.3 | 3.3278E5 |  |
 |
3.5746E5 | 2.6154E5 | 4.4472E5 | 1.70 | 1 | 55 | 67 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NAAGALDLLK.E | Y | Y | 4.56 | 2.50 | 0.5 | 2.6827E6 | |
|
1.401E6 | 3.1712E6 | 3.4759E6 | 2.48 | 1 | 20 | 29 | |
| K.TGGTQTDLFTC(+57.02)GK.C | Y | Y | 5.42 | 2.65 | 0.5 | 2.3602E6 | |
|
1.1106E6 | 2.8371E6 | 3.133E6 | 2.82 | 1 | 254 | 266 | Carbamidomethylation |
| R.SADEPMTTFVVC(+57.02)NEC(+57.02)GNR.W | Y | Y | 14.23 | 8.29 | 1.0 | 7.1143E5 | |
|
2.0623E5 | 8.1768E5 | 1.1104E6 | 5.38 | 1 | 281 | 298 | Carbamidomethylation |
| R.KQSTDEEVTSLAK.S | N | Y | 5.66 | 1.73 | 2.3 | 3.3278E5 | |
|
3.5746E5 | 2.6154E5 | 4.4472E5 | 1.70 | 1 | 55 | 67 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.AEAC(+57.02)FVNC(+57.02)VER.F | Y | Y | 5.21 | 4.52 | 0.9 | 3.2483E6 | |
|
1.2185E6 | 4.0996E6 | 4.4268E6 | 3.63 | 1 | 59 | 69 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ALAFHPVEPVLVTASEDHTLK.L | Y | Y | 7.25 | 3.86 | 1.4 | 1.6124E6 |  |
 |
2.5608E6 | 8.8294E5 | 1.3934E6 | 2.90 | 1 | 435 | 455 | |
| R.QYLQEVGYTDTILDVR.S | Y | Y | 14.87 | 1.86 | 1.2 | 1.6343E5 |  |
 |
2.0608E5 | 1.3114E5 | 1.5309E5 | 1.57 | 1 | 179 | 194 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ALAFHPVEPVLVTASEDHTLK.L | Y | Y | 7.25 | 3.86 | 1.4 | 1.6124E6 | |
|
2.5608E6 | 8.8294E5 | 1.3934E6 | 2.90 | 1 | 398 | 418 | |
| R.QYLQEVGYTDTILDVR.S | Y | Y | 14.87 | 1.86 | 1.2 | 1.6343E5 | |
|
2.0608E5 | 1.3114E5 | 1.5309E5 | 1.57 | 1 | 179 | 194 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ALAFHPVEPVLVTASEDHTLK.L | Y | Y | 7.25 | 3.86 | 1.4 | 1.6124E6 | |
|
2.5608E6 | 8.8294E5 | 1.3934E6 | 2.90 | 1 | 482 | 502 | |
| R.QYLQEVGYTDTILDVR.S | Y | Y | 14.87 | 1.86 | 1.2 | 1.6343E5 | |
|
2.0608E5 | 1.3114E5 | 1.5309E5 | 1.57 | 1 | 179 | 194 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ALAFHPVEPVLVTASEDHTLK.L | Y | Y | 7.25 | 3.86 | 1.4 | 1.6124E6 | |
|
2.5608E6 | 8.8294E5 | 1.3934E6 | 2.90 | 1 | 445 | 465 | |
| R.QYLQEVGYTDTILDVR.S | Y | Y | 14.87 | 1.86 | 1.2 | 1.6343E5 | |
|
2.0608E5 | 1.3114E5 | 1.5309E5 | 1.57 | 1 | 179 | 194 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IGGVQQDTILAEGLHFR.I | Y | Y | 6.61 | 2.79 | 0.5 | 1.8659E7 |  |
 |
1.0569E7 | 2.3465E7 | 2.1943E7 | 2.22 | 1 | 55 | 71 | |
| K.IVQAEGEAEAAK.M | Y | Y | 4.54 | 4.11 | 0.6 | 1.0627E7 |  |
|
5.5524E6 | 1.6282E7 | 1.4116E7 | 2.93 | 1 | 225 | 236 | |
| R.AQVSLLIR.R | Y | Y | 5.02 | 3.61 | 0.7 | 8.0665E6 |  |
 |
3.9194E6 | 1.0262E7 | 1.0018E7 | 2.62 | 1 | 158 | 165 | |
| R.VLSRPNAQELPSMYQR.L | N | Y | 6.48 | 5.27 | 3.9 | 6.5799E6 |  |
 |
2.5432E6 | 7.8456E6 | 9.3509E6 | 3.68 | 1 | 108 | 123 | |
| R.AQFLVEK.A | N | Y | 3.55 | 2.07 | 0.9 | 5.2062E6 |  |
 |
2.8609E6 | 8.463E6 | 8.5473E6 | 2.99 | 1 | 210 | 216 | |
| K.DLQMVNISLR.V | N | Y | 3.97 | 4.56 | 7.3 | 3.4381E6 |  |
 |
9.3603E5 | 3.1018E6 | 6.2763E6 | 6.71 | 1 | 98 | 107 | |
| K.LLLGAGAVAYGVR.E | N | Y | 5.68 | 6.36 | 0.6 | 3.1601E6 |  |
 |
1.1603E6 | 3.9618E6 | 4.3582E6 | 3.76 | 1 | 25 | 37 | |
| R.VLPSIVNEVLK.S | N | Y | 4.26 | 2.89 | 3.8 | 1.2435E6 |  |
 |
6.5291E5 | 1.9464E6 | 1.1312E6 | 2.98 | 1 | 132 | 142 | |
| total 8 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IGGVQQDTILAEGLHFR.I | Y | Y | 6.61 | 2.79 | 0.5 | 1.8659E7 | |
|
1.0569E7 | 2.3465E7 | 2.1943E7 | 2.22 | 1 | 55 | 71 | |
| K.IVQAEGEAEAAK.M | Y | Y | 4.54 | 4.11 | 0.6 | 1.0627E7 | |
|
5.5524E6 | 1.6282E7 | 1.4116E7 | 2.93 | 1 | 225 | 236 | |
| R.AQVSLLIR.R | Y | Y | 5.02 | 3.61 | 0.7 | 8.0665E6 | |
|
3.9194E6 | 1.0262E7 | 1.0018E7 | 2.62 | 1 | 158 | 165 | |
| R.VLSRPNAQELPSMYQR.L | N | Y | 6.48 | 5.27 | 3.9 | 6.5799E6 | |
|
2.5432E6 | 7.8456E6 | 9.3509E6 | 3.68 | 1 | 108 | 123 | |
| R.AQFLVEK.A | N | Y | 3.55 | 2.07 | 0.9 | 5.2062E6 | |
|
2.8609E6 | 8.463E6 | 8.5473E6 | 2.99 | 1 | 210 | 216 | |
| K.DLQMVNISLR.V | N | Y | 3.97 | 4.56 | 7.3 | 3.4381E6 | |
|
9.3603E5 | 3.1018E6 | 6.2763E6 | 6.71 | 1 | 98 | 107 | |
| K.LLLGAGAVAYGVR.E | N | Y | 5.68 | 6.36 | 0.6 | 3.1601E6 | |
|
1.1603E6 | 3.9618E6 | 4.3582E6 | 3.76 | 1 | 25 | 37 | |
| R.VLPSIVNEVLK.S | N | Y | 4.26 | 2.89 | 3.8 | 1.2435E6 | |
|
6.5291E5 | 1.9464E6 | 1.1312E6 | 2.98 | 1 | 132 | 142 | |
| total 8 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IGGVQQDTILAEGLHFR.I | Y | Y | 6.61 | 2.79 | 0.5 | 1.8659E7 | |
|
1.0569E7 | 2.3465E7 | 2.1943E7 | 2.22 | 1 | 55 | 71 | |
| K.IVQAEGEAEAAK.M | Y | Y | 4.54 | 4.11 | 0.6 | 1.0627E7 | |
|
5.5524E6 | 1.6282E7 | 1.4116E7 | 2.93 | 1 | 225 | 236 | |
| R.AQVSLLIR.R | Y | Y | 5.02 | 3.61 | 0.7 | 8.0665E6 | |
|
3.9194E6 | 1.0262E7 | 1.0018E7 | 2.62 | 1 | 158 | 165 | |
| R.VLSRPNAQELPSMYQR.L | N | Y | 6.48 | 5.27 | 3.9 | 6.5799E6 | |
|
2.5432E6 | 7.8456E6 | 9.3509E6 | 3.68 | 1 | 108 | 123 | |
| R.AQFLVEK.A | N | Y | 3.55 | 2.07 | 0.9 | 5.2062E6 | |
|
2.8609E6 | 8.463E6 | 8.5473E6 | 2.99 | 1 | 210 | 216 | |
| K.DLQMVNISLR.V | N | Y | 3.97 | 4.56 | 7.3 | 3.4381E6 | |
|
9.3603E5 | 3.1018E6 | 6.2763E6 | 6.71 | 1 | 98 | 107 | |
| K.LLLGAGAVAYGVR.E | N | Y | 5.68 | 6.36 | 0.6 | 3.1601E6 | |
|
1.1603E6 | 3.9618E6 | 4.3582E6 | 3.76 | 1 | 25 | 37 | |
| R.VLPSIVNEVLK.S | N | Y | 4.26 | 2.89 | 3.8 | 1.2435E6 | |
|
6.5291E5 | 1.9464E6 | 1.1312E6 | 2.98 | 1 | 132 | 142 | |
| total 8 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.DLLHPSPEEEK.R | Y | Y | 5.87 | 3.72 | 0.6 | 9.9874E6 | |
|
5.4122E6 | 1.3579E7 | 1.4366E7 | 2.65 | 1 | 6 | 16 | |
| K.DLLHPSPEEEKR.K | N | Y | 5.62 | 5.42 | 2.5 | 3.3852E6 |  |
 |
1.5404E6 | 3.3308E6 | 5.2843E6 | 3.43 | 1 | 6 | 17 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VVVSGLPPSGSWQDLK.D | Y | Y | 5.41 | 1.30 | 0.8 | 3.1628E7 |  |
 |
2.2555E7 | 3.6694E7 | 3.5635E7 | 1.63 | 1 | 123 | 138 | |
| R.IYVGNLPPDIR.T | Y | Y | 5.01 | 2.21 | 1.4 | 3.1299E7 |  |
 |
1.9277E7 | 3.8682E7 | 3.5938E7 | 2.01 | 1 | 18 | 28 | |
| R.DGTGVVEFVR.K | Y | Y | 4.34 | 7.00 | 1.3 | 1.6942E7 |  |
 |
3.2296E6 | 2.3775E7 | 2.3822E7 | 7.38 | 1 | 155 | 164 | |
| R.EAGDVC(+57.02)YADVYR.D | N | Y | 5.27 | 13.87 | 0.7 | 1.4145E7 |  |
 |
1.3189E6 | 2.0125E7 | 2.0992E7 | 15.92 | 1 | 143 | 154 | Carbamidomethylation |
| R.GGPPFAFVEFEDPR.D | N | Y | 4.89 | 1.75 | 0.4 | 1.3249E7 |  |
 |
9.3564E6 | 1.8842E7 | 1.1548E7 | 2.01 | 1 | 52 | 65 | |
| R.KEDMTYAVR.K | N | Y | 4.44 | 2.03 | 0.6 | 5.8541E6 |  |
 |
3.8432E6 | 7.5384E6 | 8.0652E6 | 2.10 | 1 | 165 | 173 | |
| R.TKDIEDVFYK.Y | N | Y | 6.56 | 1.74 | 0.9 | 1.0725E7 |  |
 |
7.3297E6 | 1.1265E7 | 1.3582E7 | 1.85 | 2 | 29 | 38 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VVVSGLPPSGSWQDLK.D | Y | Y | 5.41 | 1.30 | 0.8 | 3.1628E7 | |
|
2.2555E7 | 3.6694E7 | 3.5635E7 | 1.63 | 1 | 123 | 138 | |
| R.IYVGNLPPDIR.T | Y | Y | 5.01 | 2.21 | 1.4 | 3.1299E7 | |
|
1.9277E7 | 3.8682E7 | 3.5938E7 | 2.01 | 1 | 18 | 28 | |
| R.DGTGVVEFVR.K | Y | Y | 4.34 | 7.00 | 1.3 | 1.6942E7 | |
|
3.2296E6 | 2.3775E7 | 2.3822E7 | 7.38 | 1 | 155 | 164 | |
| R.EAGDVC(+57.02)YADVYR.D | N | Y | 5.27 | 13.87 | 0.7 | 1.4145E7 | |
|
1.3189E6 | 2.0125E7 | 2.0992E7 | 15.92 | 1 | 143 | 154 | Carbamidomethylation |
| R.GGPPFAFVEFEDPR.D | N | Y | 4.89 | 1.75 | 0.4 | 1.3249E7 | |
|
9.3564E6 | 1.8842E7 | 1.1548E7 | 2.01 | 1 | 52 | 65 | |
| R.KEDMTYAVR.K | N | Y | 4.44 | 2.03 | 0.6 | 5.8541E6 | |
|
3.8432E6 | 7.5384E6 | 8.0652E6 | 2.10 | 1 | 165 | 173 | |
| R.TKDIEDVFYK.Y | N | Y | 6.56 | 1.74 | 0.9 | 1.0725E7 | |
|
7.3297E6 | 1.1265E7 | 1.3582E7 | 1.85 | 2 | 29 | 38 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LGMENDDTAVQYAIGR.S | Y | Y | 11.87 | 2.60 | 2.3 | 9.366E5 | |
|
1.4224E6 | 6.2696E5 | 7.6048E5 | 2.27 | 1 | 56 | 71 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VWTANPQQFVEDEDDDTFSYTVR.I | Y | Y | 7.40 | 2.46 | 1.1 | 7.9119E5 |  |
 |
1.2071E6 | 5.3503E5 | 6.314E5 | 2.26 | 1 | 382 | 404 | |
| M.A(+42.01)AAAAAGAASGLPGPVAQGLK.E | Y | Y | 6.26 | 6.05 | 0.8 | 4.5023E6 |  |
 |
7.0356E6 | 2.9123E6 | 3.5591E6 | 2.42 | 2 | 2 | 22 | Acetylation (N-term) |
| K.FRPPETTER.A | Y | Y | 5.47 | 3.76 | 2.6 | 6.8495E5 |  |
 |
1.0306E6 | 3.899E5 | 7.3187E5 | 2.64 | 1 | 96 | 104 | |
| K.IFTMAEVYGIR.T | N | Y | 4.81 | 3.18 | 2.7 | 6.0733E5 |  |
 |
7.1945E5 | 3.1936E5 | 7.8319E5 | 2.45 | 1 | 196 | 206 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LGLPPLTPEQQEALQK.A | Y | Y | 5.93 | 1.77 | 0.6 | 8.2492E6 |  |
|
4.9808E6 | 9.9284E6 | 9.8385E6 | 1.99 | 1 | 108 | 123 | |
| K.QGEEEDAEIIVK.I | Y | Y | 4.11 | 8.63 | 5.5 | 7.0708E6 |  |
 |
1.4072E6 | 1.0088E7 | 9.7175E6 | 7.17 | 1 | 540 | 551 | |
| K.VGRPSNIGQAQPIIDQLAEEAR.A | Y | Y | 7.72 | 1.12 | 0.7 | 6.1483E6 |  |
 |
4.9191E6 | 5.988E6 | 7.5377E6 | 1.53 | 1 | 239 | 260 | |
| K.VVAEVYDQER.F | N | Y | 4.76 | 0.49 | 2.7 | 4.5623E6 |  |
 |
5.4056E6 | 4.8127E6 | 4.6717E6 | 1.16 | 1 | 579 | 588 | |
| R.VYVGSIYYELGEDTIR.Q | N | Y | 8.32 | 4.52 | 5.6 | 1.3841E6 |  |
 |
1.1682E6 | 2.486E6 | 4.9799E5 | 4.99 | 1 | 168 | 183 | |
| K.QTIAHQQQQLTNLQMAAQR.Q | N | Y | 15.90 | 2.61 | 0.8 | 9.3864E5 |  |
 |
7.0913E5 | 1.3285E6 | 9.5555E5 | 1.87 | 1 | 140 | 158 | |
| R.KVVAEVYDQER.F | N | Y | 4.27 | 2.66 | 3.9 | 5.5383E5 |  |
|
2.8114E5 | 7.8715E5 | 7.8997E5 | 2.81 | 1 | 578 | 588 | |
| R.IYVASVHQDLSDDDIK.S | N | Y | 21.00 | 5.04 | 0.9 | 5.224E5 |  |
 |
2.8172E5 | 6.792E5 | 6.0628E5 | 2.41 | 1 | 265 | 280 | |
| total 8 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VVLIGDSGVGK.S | Y | Y | 5.22 | 3.94 | 0.5 | 2.27E7 |  |
 |
3.4734E7 | 1.42E7 | 1.9167E7 | 2.45 | 1 | 14 | 24 | |
| R.DDEYDYLFK.V | Y | Y | 5.56 | 1.54 | 0.7 | 2.293E6 |  |
 |
2.9709E6 | 2.0016E6 | 1.9064E6 | 1.56 | 1 | 5 | 13 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M.S(+42.01)HTILLVQPTK.R | Y | Y | 6.66 | 2.12 | 0.4 | 6.1801E7 |  |
 |
3.9213E7 | 6.9746E7 | 7.6442E7 | 1.95 | 1 | 2 | 12 | Acetylation (N-term) |
| R.TYADYESVNEC(+57.02)MEGVC(+57.02)K.M | Y | Y | 6.04 | 3.81 | 0.8 | 1.7216E7 |  |
 |
8.2895E6 | 2.1288E7 | 2.2072E7 | 2.66 | 1 | 18 | 34 | Carbamidomethylation |
| R.ADTQTYQPYNK.D | Y | Y | 4.78 | 3.31 | 0.8 | 7.4852E6 |  |
 |
4.5791E6 | 1.1033E7 | 9.6014E6 | 2.41 | 1 | 74 | 84 | |
| R.TYADYESVNEC(+57.02)M(+15.99)EGVC(+57.02)K.M | N | Y | 7.70 | 3.62 | 1.2 | 8.8485E5 |  |
|
3.5032E5 | 1.1603E6 | 1.144E6 | 3.31 | 1 | 18 | 34 | Carbamidomethylation; Oxidation (M) |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LVGSQEELASWGHEYVR.H | Y | Y | 12.66 | 2.51 | 0.7 | 1.1507E7 |  |
 |
1.6857E7 | 7.7554E6 | 9.91E6 | 2.17 | 2 | 144 | 160 | |
| R.VGQAVDVVGQAGKPK.T | Y | Y | 8.90 | 3.03 | 0.7 | 9.9252E6 |  |
 |
1.6091E7 | 6.3382E6 | 8.9313E6 | 2.54 | 2 | 846 | 860 | |
| R.LNILDTLSK.F | Y | Y | 5.28 | 3.93 | 0.6 | 7.1625E6 |  |
 |
1.0769E7 | 4.752E6 | 5.9667E6 | 2.27 | 1 | 704 | 712 | |
| K.SGALLAC(+57.02)GIVNSGVR.N | N | Y | 6.39 | 2.60 | 0.7 | 5.6302E6 |  |
 |
7.9351E6 | 3.7066E6 | 5.249E6 | 2.14 | 1 | 442 | 456 | Carbamidomethylation |
| R.EPLLTLVK.E | N | Y | 4.73 | 0.96 | 0.9 | 5.4893E6 |  |
 |
6.3674E6 | 4.4532E6 | 5.6472E6 | 1.43 | 1 | 182 | 189 | |
| K.YLYSSEDYIK.S | N | Y | 6.23 | 2.14 | 0.4 | 4.4169E6 |  |
 |
5.8644E6 | 3.1083E6 | 4.278E6 | 1.89 | 1 | 432 | 441 | |
| K.VQQLLHIC(+57.02)SEHFDSK.E | N | Y | 6.69 | 3.29 | 1.0 | 4.1975E6 |  |
 |
5.7296E6 | 2.3305E6 | 4.5324E6 | 2.46 | 1 | 609 | 623 | Carbamidomethylation |
| R.C(+57.02)ALGVFR.K | N | Y | 4.95 | 12.53 | 0.7 | 3.3188E6 |  |
|
7.7267E6 | 1.0042E6 | 1.2256E6 | 7.69 | 1 | 251 | 257 | Carbamidomethylation |
| K.EWQELDDAEK.A | N | Y | 4.80 | 0.34 | 0.9 | 2.9454E6 |  |
 |
3.0304E6 | 2.73E6 | 3.0759E6 | 1.13 | 1 | 169 | 178 | |
| K.TITGFQTHTTPVLLAHGER.A | N | Y | 6.90 | 5.97 | 0.6 | 2.9374E6 |  |
 |
5.0943E6 | 1.4038E6 | 2.314E6 | 3.63 | 1 | 861 | 879 | |
| R.FGGSGSQVDSAR.M | N | Y | 6.30 | 1.36 | 1.3 | 2.8224E6 |  |
 |
3.547E6 | 2.1767E6 | 3.2876E6 | 1.63 | 1 | 358 | 369 | |
| K.DPNNLFMVR.L | N | Y | 5.76 | 3.17 | 0.9 | 1.9479E6 |  |
 |
2.6561E6 | 1.2956E6 | 1.8919E6 | 2.05 | 1 | 755 | 763 | |
| R.LGSIFGLGLAYAGSNR.E | N | Y | 6.06 | 5.64 | 0.9 | 8.1754E5 |  |
 |
1.3908E6 | 6.5476E5 | 4.071E5 | 3.42 | 1 | 479 | 494 | |
| K.VC(+57.02)LYLTSC(+57.02)VNYVPEPENSALLR.C | N | Y | 5.64 | 1.85 | 3.0 | 1.8141E6 |  |
 |
2.2594E6 | 1.3155E6 | 1.9955E6 | 1.72 | 2 | 229 | 250 | Carbamidomethylation |
| K.FSHDADPEVSYNSIFAMGMVGSGTNNAR.L | N | Y | 8.36 | 2.63 | 1.1 | 4.3793E5 |  |
 |
7.1961E5 | 2.7953E5 | 4.1954E5 | 2.57 | 1 | 713 | 740 | |
| total 15 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.EGDVLTLLESER.E | Y | Y | 6.24 | 3.66 | 0.5 | 5.8218E7 |  |
 |
3.4695E7 | 6.6527E7 | 7.3431E7 | 2.12 | 1 | 52 | 63 | |
| R.VEFMDDTSR.S | Y | Y | 5.40 | 2.89 | 1.0 | 3.2124E7 |  |
|
2.0754E7 | 3.4067E7 | 4.155E7 | 2.00 | 1 | 32 | 40 | |
| R.TGSQGQC(+57.02)TQVR.V | Y | Y | 7.03 | 1.14 | 2.7 | 2.7336E4 |  |
 |
3.6204E4 | 2.318E4 | 2.8419E4 | 1.56 | 1 | 21 | 31 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.APKPEDIDEEDDDVPDLVENFDEASKNEAN | Y | Y | 8.16 | 3.18 | 0.9 | 2.8904E6 | |
|
1.449E6 | 3.0612E6 | 4.1611E6 | 2.87 | 1 | 129 | 158 | |
| K.APKPEDIDEEDDDVPDLVENFDEASK.N | N | Y | 6.90 | 5.14 | 3.3 | 2.0176E6 |  |
 |
1.0344E6 | 3.2801E6 | 2.5584E6 | 3.17 | 1 | 129 | 154 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.TTPTGWTLDQC(+57.02)IQTGVDNPGHPFIK.T | Y | Y | 7.60 | 1.94 | 0.4 | 6.192E6 |  |
 |
4.3227E6 | 6.125E6 | 8.1284E6 | 1.88 | 1 | 80 | 104 | Carbamidomethylation |
| R.VVVDALSGLK.G | Y | Y | 4.66 | 3.67 | 0.6 | 5.9617E6 |  |
 |
2.8676E6 | 6.5626E6 | 8.455E6 | 2.95 | 1 | 191 | 200 | |
| R.LSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMAR.D | Y | Y | 14.16 | 2.34 | 0.7 | 3.2853E6 |  |
 |
2.0813E6 | 3.8205E6 | 3.9541E6 | 1.90 | 1 | 210 | 243 | |
| R.LYPPSAEYPDLR.K | N | Y | 3.97 | 0.80 | 6.5 | 2.7724E6 |  |
 |
3.583E6 | 2.3773E6 | 2.3569E6 | 1.52 | 1 | 47 | 58 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SQGGEPTYNVAVGR.A | Y | Y | 5.64 | 4.16 | 1.1 | 1.9454E7 | |
|
3.7133E7 | 1.1766E7 | 1.2404E7 | 3.16 | 1 | 92 | 105 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SQGGEPTYNVAVGR.A | Y | Y | 5.64 | 4.16 | 1.1 | 1.9454E7 | |
|
3.7133E7 | 1.1766E7 | 1.2404E7 | 3.16 | 1 | 92 | 105 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IAILTC(+57.02)PFEPPKPK.T | Y | Y | 6.42 | 1.81 | 0.5 | 2.1127E7 |  |
 |
1.5835E7 | 2.0784E7 | 2.6761E7 | 1.69 | 1 | 248 | 261 | Carbamidomethylation |
| K.LDVTSVEDYK.A | Y | Y | 5.82 | 4.36 | 0.6 | 1.5631E7 |  |
 |
9.0995E6 | 1.8358E7 | 1.9437E7 | 2.14 | 1 | 266 | 275 | |
| K.LMVELSK.S | Y | Y | 6.29 | 4.19 | 3.5 | 1.2439E7 |  |
 |
4.9732E6 | 1.5135E7 | 1.721E7 | 3.46 | 1 | 90 | 96 | |
| R.IADGYEQAAR.I | N | Y | 4.00 | 3.59 | 4.8 | 1.1171E7 |  |
 |
5.7085E6 | 5.5465E6 | 2.3644E7 | 4.26 | 1 | 133 | 142 | |
| R.DVDFELIK.V | N | Y | 4.71 | 7.22 | 0.6 | 8.4353E6 |  |
 |
1.947E6 | 1.0272E7 | 1.3574E7 | 6.97 | 1 | 203 | 210 | |
| K.MLVIEQC(+57.02)K.N | N | Y | 3.47 | 2.16 | 11.3 | 8.0718E6 |  |
 |
4.793E6 | 5.0051E6 | 1.4417E7 | 3.01 | 1 | 371 | 378 | Carbamidomethylation |
| K.HKLDVTSVEDYK.A | N | Y | 5.65 | 1.67 | 1.0 | 8.1935E6 |  |
 |
7.8109E6 | 6.9088E6 | 1.1588E7 | 1.68 | 2 | 264 | 275 | |
| K.QQISLATQMVR.M | N | Y | 6.93 | 1.93 | 2.7 | 5.7239E6 |  |
 |
4.3266E6 | 5.4382E6 | 7.4071E6 | 1.71 | 1 | 515 | 525 | |
| K.KQQISLATQMVR.M | N | Y | 6.23 | 5.22 | 1.0 | 5.0581E6 |  |
 |
2.1996E6 | 5.377E6 | 8.0089E6 | 3.64 | 2 | 514 | 525 | |
| R.VVYGGGAAEISC(+57.02)ALAVSQEADK.C | N | Y | 7.29 | 1.82 | 0.6 | 8.5119E6 |  |
 |
5.6586E6 | 9.7345E6 | 1.0143E7 | 1.79 | 2 | 418 | 439 | Carbamidomethylation |
| K.DGDVTVTNDGATILSMMDVDHQIAK.L | N | Y | 5.15 | 3.81 | 1.4 | 4.4674E6 |  |
 |
2.7018E6 | 6.0554E6 | 4.6448E6 | 2.24 | 1 | 65 | 89 | |
| K.GVIVDKDFSHPQMPK.E | N | Y | 6.85 | 1.44 | 0.6 | 1.1738E7 |  |
 |
9.4173E6 | 1.0067E7 | 1.5731E7 | 1.67 | 2 | 227 | 241 | |
| R.AVTIFIR.G | N | Y | 5.29 | 5.91 | 3.0 | 3.4859E6 |  |
 |
1.4214E6 | 3.1295E6 | 5.9069E6 | 4.16 | 1 | 382 | 388 | |
| R.VVYGGGAAEISC(+57.02)ALAVSQEADKC(+57.02)PTLEQYAMR.A | N | Y | 9.98 | 1.63 | 0.7 | 1.155E7 |  |
 |
8.5407E6 | 9.9933E6 | 1.6117E7 | 1.89 | 2 | 418 | 449 | Carbamidomethylation |
| K.C(+57.02)PTLEQYAMR.A | N | Y | 6.81 | 3.59 | 0.9 | 2.1895E6 |  |
 |
1.1383E6 | 2.4579E6 | 2.9722E6 | 2.61 | 1 | 440 | 449 | Carbamidomethylation |
| K.MIIEEAKR.S | N | Y | 4.34 | 5.28 | 1.0 | 6.4014E5 |  |
 |
2.4967E5 | 5.2066E5 | 1.2802E6 | 5.13 | 1 | 393 | 400 | |
| total 16 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ELISNSSDALDK.I | Y | Y | 5.06 | 4.75 | 1.3 | 9.3578E7 |  |
 |
3.5288E7 | 9.5415E7 | 1.5003E8 | 4.25 | 1 | 47 | 58 | |
| R.NPDDITNEEYGEFYK.S | N | Y | 6.75 | 0.86 | 0.5 | 8.8855E7 |  |
 |
7.6121E7 | 8.6733E7 | 1.0371E8 | 1.36 | 1 | 301 | 315 | |
| R.YYTSASGDEMVSLK.D | N | Y | 6.13 | 2.13 | 0.4 | 6.2278E7 |  |
 |
4.5963E7 | 5.9703E7 | 8.1169E7 | 1.77 | 1 | 466 | 479 | |
| K.HSQFIGYPITLFVEK.E | N | Y | 5.64 | 0.41 | 0.8 | 7.7298E7 |  |
 |
7.133E7 | 8.1889E7 | 7.8676E7 | 1.15 | 2 | 210 | 224 | |
| K.DQVANSAFVER.L | N | Y | 5.54 | 8.75 | 1.5 | 5.5128E7 |  |
 |
1.8938E7 | 6.1323E7 | 8.5124E7 | 4.49 | 1 | 501 | 511 | |
| K.FYEQFSK.N | N | Y | 5.02 | 5.36 | 0.7 | 4.9616E7 |  |
 |
2.4471E7 | 5.4667E7 | 8.3377E7 | 3.41 | 1 | 438 | 444 | |
| R.ALLFVPR.R | N | Y | 5.10 | 5.39 | 0.8 | 4.5122E7 |  |
 |
1.8372E7 | 5.0144E7 | 6.6849E7 | 3.64 | 1 | 340 | 346 | |
| K.TLVSVTK.E | N | Y | 4.68 | 3.43 | 0.6 | 3.0889E7 |  |
 |
1.753E7 | 3.1948E7 | 5.1175E7 | 2.92 | 1 | 541 | 547 | |
| K.ELHINLIPNK.Q | N | Y | 5.89 | 3.18 | 0.5 | 3.9043E7 |  |
 |
2.2519E7 | 4.2556E7 | 5.2053E7 | 2.31 | 2 | 75 | 84 | |
| K.KHLEINPDHSIIETLR.Q | N | Y | 5.20 | 1.60 | 0.6 | 2.186E7 |  |
 |
2.7768E7 | 1.5962E7 | 2.1852E7 | 1.74 | 1 | 633 | 648 | |
| R.DNSTMGYMAAK.K | N | Y | 4.36 | 2.74 | 0.7 | 1.401E7 |  |
 |
7.9571E6 | 1.3786E7 | 2.3734E7 | 2.98 | 1 | 622 | 632 | |
| K.HGLEVIYMIEPIDEYC(+57.02)VQQLK.E | N | Y | 6.17 | 0.63 | 3.2 | 1.2414E7 |  |
 |
1.1149E7 | 1.3297E7 | 1.3029E7 | 1.19 | 2 | 515 | 535 | Carbamidomethylation |
| R.APFDLFENR.K | N | Y | 5.23 | 2.24 | 0.6 | 1.2217E7 |  |
 |
1.7969E7 | 9.7956E6 | 8.8879E6 | 2.02 | 1 | 348 | 356 | |
| R.LVTSPC(+57.02)C(+57.02)IVTSTYGWTANMER.I | N | Y | 6.35 | 0.98 | 0.8 | 3.4234E7 |  |
 |
2.9143E7 | 2.9869E7 | 4.3689E7 | 1.50 | 2 | 593 | 613 | Carbamidomethylation |
| R.YYTSASGDEM(+15.99)VSLK.D | N | Y | 3.16 | 0.07 | 0.4 | 8.4972E6 |  |
 |
8.1673E6 | 8.6433E6 | 8.6809E6 | 1.06 | 1 | 466 | 479 | Oxidation (M) |
| K.KHSQFIGYPITLFVEK.E | N | Y | 4.96 | 1.06 | 0.9 | 5.9255E6 |  |
 |
6.9497E6 | 4.8137E6 | 6.0132E6 | 1.44 | 1 | 209 | 224 | |
| R.RAPFDLFENR.K | Y | Y | 5.79 | 2.32 | 0.7 | 9.0696E7 |  |
 |
6.5659E7 | 8.4405E7 | 1.2202E8 | 1.86 | 2 | 347 | 356 | |
| K.ELHINLIPNKQDR.T | N | Y | 6.08 | 6.43 | 0.8 | 4.3174E6 |  |
 |
3.991E6 | 2.3667E6 | 6.5946E6 | 2.79 | 1 | 75 | 87 | |
| R.LVTSPC(+57.02)C(+57.02)IVTSTYGWTANM(+15.99)ER.I | N | Y | 4.39 | 3.76 | 1.3 | 4.252E6 |  |
 |
2.3926E6 | 2.6616E6 | 7.7017E6 | 3.22 | 1 | 593 | 613 | Carbamidomethylation; Oxidation (M) |
| K.HGLEVIYM(+15.99)IEPIDEYC(+57.02)VQQLK.E | N | Y | 4.78 | 0.75 | 1.2 | 1.6048E6 |  |
 |
1.7927E6 | 1.9034E6 | 1.491E6 | 1.28 | 1 | 515 | 535 | Oxidation (M); Carbamidomethylation |
| K.HLEINPDHSIIETLR.Q | Y | Y | 5.49 | 0.86 | 0.7 | 9.3894E7 |  |
 |
8.1872E7 | 9.4552E7 | 1.055E8 | 1.29 | 3 | 634 | 648 | |
| K.LGIHEDSQNR.K | N | Y | 5.63 | 1.86 | 0.7 | 1.4375E5 |  |
 |
1.2061E5 | 1.3462E5 | 2.0967E5 | 1.74 | 1 | 448 | 457 | |
| total 22 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IEGLQNLVNLR.E | Y | Y | 5.75 | 3.81 | 0.5 | 2.557E6 |  |
 |
3.792E6 | 1.6793E6 | 2.1996E6 | 2.26 | 1 | 245 | 255 | |
| R.GAGQQQSQEMMEVDR.R | Y | Y | 9.56 | 12.32 | 1.2 | 3.3499E5 |  |
 |
7.0378E5 | 2.1907E4 | 2.9023E5 | 32.13 | 1 | 6 | 20 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IEGLQNLVNLR.E | Y | Y | 5.75 | 3.81 | 0.5 | 2.557E6 | |
|
3.792E6 | 1.6793E6 | 2.1996E6 | 2.26 | 1 | 245 | 255 | |
| R.GAGQQQSQEMMEVDR.R | Y | Y | 9.56 | 12.32 | 1.2 | 3.3499E5 | |
|
7.0378E5 | 2.1907E4 | 2.9023E5 | 32.13 | 1 | 6 | 20 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LQMEQQQQLQQR.Q | Y | Y | 5.86 | 4.22 | 0.7 | 3.4458E6 |  |
 |
1.6223E6 | 5.5424E6 | 4.5583E6 | 3.42 | 1 | 106 | 117 | |
| R.LWGLTEMFPER.V | Y | Y | 4.44 | 4.34 | 0.6 | 2.3748E6 |  |
 |
9.1322E5 | 3.9363E6 | 2.275E6 | 4.31 | 1 | 48 | 58 | |
| R.SAAGATFDLSLFVAQK.M | Y | Y | 4.90 | 2.32 | 0.8 | 1.8966E6 |  |
 |
1.2311E6 | 2.9069E6 | 1.552E6 | 2.36 | 1 | 61 | 76 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M.T(+42.01)DAAVSFAK.D | Y | Y | 5.46 | 2.47 | 0.4 | 1.2814E7 |  |
 |
8.3088E6 | 1.269E7 | 1.7444E7 | 2.10 | 1 | 2 | 10 | Acetylation (N-term) |
| K.GTDIMYTGTLDC(+57.02)WR.K | Y | Y | 5.17 | 2.83 | 1.3 | 7.8411E6 |  |
 |
4.1552E6 | 8.5016E6 | 1.0866E7 | 2.62 | 1 | 246 | 259 | Carbamidomethylation |
| R.KGTDIMYTGTLDC(+57.02)WR.K | N | Y | 10.30 | 2.35 | 1.9 | 4.4634E6 |  |
 |
2.9934E6 | 4.4335E6 | 6.0631E6 | 2.03 | 2 | 245 | 259 | Carbamidomethylation |
| K.GTDIM(+15.99)YTGTLDC(+57.02)WR.K | N | Y | 7.01 | 3.70 | 0.9 | 7.453E5 |  |
 |
3.3874E5 | 8.6821E5 | 1.029E6 | 3.04 | 1 | 246 | 259 | Oxidation (M); Carbamidomethylation |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M.S(+42.01)SVAVLTQESFAEHR.S | Y | Y | 6.83 | 1.23 | 0.6 | 7.7215E6 |  |
 |
9.9254E6 | 6.423E6 | 6.8161E6 | 1.55 | 1 | 2 | 16 | Acetylation (N-term) |
| K.IQIPRPDDPSNQIK.I | Y | Y | 6.02 | 3.18 | 0.7 | 5.439E6 |  |
 |
8.6375E6 | 3.4946E6 | 4.2149E6 | 2.47 | 2 | 184 | 197 | |
| K.LGQALTEVYAK.A | N | Y | 6.09 | 2.30 | 0.7 | 4.3222E6 |  |
 |
5.5715E6 | 3.4279E6 | 3.9672E6 | 1.63 | 1 | 350 | 360 | |
| K.IVGELEQMVSEDVPLDHR.V | Y | Y | 4.33 | 3.49 | 4.9 | 6.0867E6 |  |
 |
1.1792E7 | 3.2316E6 | 3.2368E6 | 3.65 | 2 | 1120 | 1137 | |
| R.INIPPPSVNR.T | N | Y | 5.85 | 1.23 | 0.9 | 3.9207E6 |  |
 |
4.9469E6 | 3.2655E6 | 3.5496E6 | 1.51 | 1 | 256 | 265 | |
| R.TGVSVEIPPSDSISETVILR.G | N | Y | 4.72 | 0.76 | 1.3 | 3.6792E6 |  |
 |
4.3465E6 | 3.2492E6 | 3.4419E6 | 1.34 | 1 | 325 | 344 | |
| R.LVGEIMQETGTR.I | N | Y | 4.79 | 1.94 | 0.4 | 3.5595E6 |  |
 |
4.6154E6 | 2.7529E6 | 3.3101E6 | 1.68 | 1 | 244 | 255 | |
| R.LEHDVNIQFPDKDDGNQPQDQITITGYEK.N | N | Y | 9.90 | 1.21 | 1.2 | 3.3326E6 |  |
 |
5.7692E6 | 4.5463E6 | 3.4718E6 | 1.66 | 2 | 1080 | 1108 | |
| K.VATLNSEEESDPPTYK.D | N | Y | 7.99 | 1.14 | 0.7 | 2.9372E6 |  |
 |
3.6405E6 | 2.4315E6 | 2.7396E6 | 1.50 | 1 | 26 | 41 | |
| K.DLANIAEVEVSIPAK.L | N | Y | 5.80 | 0.76 | 0.7 | 2.746E6 |  |
 |
2.8416E6 | 2.4086E6 | 2.9877E6 | 1.24 | 1 | 649 | 663 | |
| K.ASVITQVFHVPLEER.K | N | Y | 6.60 | 1.02 | 0.5 | 2.4956E6 |  |
 |
3.1256E6 | 2.1078E6 | 2.2535E6 | 1.48 | 1 | 73 | 87 | |
| R.IEGDPQGVQQAK.R | N | Y | 5.44 | 1.13 | 0.5 | 2.1507E6 |  |
 |
2.6655E6 | 1.8097E6 | 2.4294E6 | 1.47 | 1 | 483 | 494 | |
| R.DKFPEVIINFPDPAQK.S | N | Y | 5.71 | 1.41 | 0.5 | 1.8177E6 |  |
|
1.3415E6 | 2.0389E6 | 2.0726E6 | 1.54 | 1 | 535 | 550 | |
| K.APDMSSSEEFPSFGAQVAPK.T | N | Y | 8.71 | 1.35 | 0.8 | 1.5974E6 |  |
 |
2.0312E6 | 1.2081E6 | 1.5528E6 | 1.68 | 1 | 1241 | 1260 | |
| K.ITLEGPTEDVNVAQEQIEGMVK.D | N | Y | 17.14 | 6.51 | 1.5 | 2.2119E5 |  |
 |
3.5577E5 | 2.2535E5 | 1.3878E5 | 2.56 | 1 | 408 | 429 | |
| total 15 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VNIIGEVVDQGSTNLK.I | Y | Y | 6.19 | 5.86 | 1.0 | 2.0492E6 |  |
 |
3.4341E6 | 1.0982E6 | 1.6152E6 | 3.13 | 1 | 192 | 207 | |
| K.EQDHIIIIPR.G | Y | Y | 7.47 | 1.73 | 0.6 | 8.9478E5 |  |
 |
1.2049E6 | 6.2175E5 | 8.5765E5 | 1.94 | 1 | 168 | 177 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VETFSGVYK.K | Y | Y | 6.00 | 1.49 | 0.6 | 4.884E7 |  |
 |
3.5204E7 | 5.1711E7 | 5.9604E7 | 1.69 | 1 | 186 | 194 | |
| K.HVVFIAQR.R | Y | Y | 5.27 | 2.32 | 0.6 | 2.8702E7 |  |
 |
1.9573E7 | 3.0338E7 | 4.378E7 | 2.24 | 1 | 107 | 114 | |
| R.ELNITAAK.E | Y | Y | 4.58 | 2.47 | 0.7 | 2.1827E7 |  |
 |
1.226E7 | 2.6116E7 | 3.3635E7 | 2.74 | 1 | 58 | 65 | |
| K.IVKPNGEKPDEFESGISQALLELEMNSDLK.A | N | Y | 8.59 | 5.88 | 1.2 | 7.2594E6 |  |
 |
5.5659E6 | 1.5283E7 | 1.8589E6 | 8.22 | 1 | 24 | 53 | |
| R.KAIIIFVPVPQLK.S | N | Y | 6.40 | 0.76 | 0.5 | 5.2718E6 |  |
 |
5.8159E6 | 4.6205E6 | 5.379E6 | 1.26 | 2 | 74 | 86 | |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VETFSGVYK.K | Y | Y | 6.00 | 1.49 | 0.6 | 4.884E7 | |
|
3.5204E7 | 5.1711E7 | 5.9604E7 | 1.69 | 1 | 170 | 178 | |
| K.HVVFIAQR.R | Y | Y | 5.27 | 2.32 | 0.6 | 2.8702E7 | |
|
1.9573E7 | 3.0338E7 | 4.378E7 | 2.24 | 1 | 91 | 98 | |
| R.ELNITAAK.E | Y | Y | 4.58 | 2.47 | 0.7 | 2.1827E7 | |
|
1.226E7 | 2.6116E7 | 3.3635E7 | 2.74 | 1 | 42 | 49 | |
| K.IVKPNGEKPDEFESGISQALLELEMNSDLK.A | N | Y | 8.59 | 5.88 | 1.2 | 7.2594E6 | |
|
5.5659E6 | 1.5283E7 | 1.8589E6 | 8.22 | 1 | 8 | 37 | |
| R.KAIIIFVPVPQLK.S | N | Y | 6.40 | 0.76 | 0.5 | 5.2718E6 | |
|
5.8159E6 | 4.6205E6 | 5.379E6 | 1.26 | 2 | 58 | 70 | |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VETFSGVYK.K | Y | Y | 6.00 | 1.49 | 0.6 | 4.884E7 | |
|
3.5204E7 | 5.1711E7 | 5.9604E7 | 1.69 | 1 | 170 | 178 | |
| K.HVVFIAQR.R | Y | Y | 5.27 | 2.32 | 0.6 | 2.8702E7 | |
|
1.9573E7 | 3.0338E7 | 4.378E7 | 2.24 | 1 | 91 | 98 | |
| R.ELNITAAK.E | Y | Y | 4.58 | 2.47 | 0.7 | 2.1827E7 | |
|
1.226E7 | 2.6116E7 | 3.3635E7 | 2.74 | 1 | 42 | 49 | |
| K.IVKPNGEKPDEFESGISQALLELEMNSDLK.A | N | Y | 8.59 | 5.88 | 1.2 | 7.2594E6 | |
|
5.5659E6 | 1.5283E7 | 1.8589E6 | 8.22 | 1 | 8 | 37 | |
| R.KAIIIFVPVPQLK.S | N | Y | 6.40 | 0.76 | 0.5 | 5.2718E6 | |
|
5.8159E6 | 4.6205E6 | 5.379E6 | 1.26 | 2 | 58 | 70 | |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.GYTLVEYETYK.E | Y | Y | 4.29 | 1.33 | 5.9 | 1.1428E7 |  |
 |
8.4904E6 | 1.2447E7 | 1.3348E7 | 1.57 | 1 | 115 | 125 | |
| M.A(+42.01)DVLDLHEAGGEDFAMDEDGDESIHK.L | Y | Y | 5.44 | 5.17 | 0.6 | 1.1304E7 |  |
 |
3.6916E6 | 1.447E7 | 1.5752E7 | 4.27 | 1 | 2 | 27 | Acetylation (N-term) |
| R.MREDYDSVEQDGDEPGPQR.S | Y | Y | 9.24 | 4.68 | 1.0 | 5.1168E6 |  |
 |
2.2825E6 | 7.4991E6 | 7.4658E6 | 3.29 | 2 | 50 | 68 | |
| R.EDYDSVEQDGDEPGPQR.S | N | Y | 5.24 | 10.12 | 1.2 | 5.7967E4 |  |
 |
2.2399E4 | 1.7951E5 | 6.7341E4 | 8.01 | 1 | 52 | 68 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ISGLIYEETR.G | Y | Y | 5.07 | 1.88 | 1.9 | 1.0354E9 |  |
 |
7.4608E8 | 1.58E9 | 1.0401E9 | 2.12 | 1 | 47 | 56 | |
| K.VFLENVIR.D | Y | Y | 6.12 | 2.40 | 1.2 | 1.0346E9 |  |
 |
6.2635E8 | 1.3528E9 | 1.1247E9 | 2.16 | 1 | 61 | 68 | |
| K.TVTAMDVVYALK.R | N | Y | 4.36 | 2.46 | 1.9 | 5.3564E8 |  |
 |
3.8352E8 | 9.6893E8 | 4.9669E8 | 2.53 | 1 | 81 | 92 | |
| R.DNIQGITKPAIR.R | Y | Y | 6.39 | 3.70 | 1.7 | 6.3601E8 |  |
 |
3.6082E8 | 9.9307E8 | 9.4989E8 | 2.75 | 2 | 25 | 36 | |
| R.KTVTAMDVVYALK.R | N | Y | 6.52 | 2.27 | 0.6 | 1.3093E8 |  |
 |
8.5947E7 | 1.5916E8 | 1.4769E8 | 1.85 | 2 | 80 | 92 | |
| K.TVTAM(+15.99)DVVYALK.R | N | Y | 4.63 | 2.32 | 1.4 | 5.6E7 |  |
 |
3.1291E7 | 6.165E7 | 7.5059E7 | 2.40 | 1 | 81 | 92 | Oxidation (M) |
| K.RISGLIYEETR.G | N | Y | 4.85 | 1.77 | 0.7 | 1.2824E7 |  |
 |
9.333E6 | 1.2741E7 | 1.6399E7 | 1.76 | 2 | 46 | 56 | |
| R.KTVTAMDVVYALKR.Q | N | Y | 7.52 | 1.94 | 1.1 | 4.3188E6 |  |
 |
3.3938E6 | 3.1005E6 | 6.462E6 | 2.08 | 1 | 80 | 93 | |
| R.KTVTAM(+15.99)DVVYALK.R | N | Y | 3.09 | 1.94 | 3.9 | 5.7652E6 |  |
 |
2.6291E6 | 9.4256E6 | 5.2408E6 | 3.59 | 2 | 80 | 92 | Oxidation (M) |
| K.TVTAMDVVYALKR.Q | N | Y | 5.00 | 2.78 | 0.7 | 1.5769E6 |  |
 |
1.0424E6 | 2.6899E6 | 9.984E5 | 2.69 | 1 | 81 | 93 | |
| R.DAVTYTEHAK.R | N | Y | 5.66 | 4.54 | 5.4 | 1.4197E6 |  |
 |
8.4939E5 | 2.5196E6 | 1.52E6 | 2.97 | 2 | 69 | 78 | |
| total 11 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LQMEAPHIIVGTPGR.V | Y | Y | 7.90 | 2.16 | 0.7 | 5.6057E7 |  |
 |
3.5464E7 | 6.105E7 | 7.1657E7 | 2.02 | 2 | 147 | 161 | |
| R.KGVAINMVTEEDKR.T | Y | Y | 5.68 | 3.08 | 0.9 | 4.2507E7 |  |
 |
2.9124E7 | 5.2351E7 | 5.9135E7 | 2.03 | 1 | 369 | 382 | |
| K.DQIYDIFQK.L | N | Y | 4.74 | 6.70 | 0.8 | 1.4812E7 |  |
 |
3.8301E6 | 2.3469E7 | 1.7136E7 | 6.13 | 1 | 194 | 202 | |
| K.ATQALVLAPTR.E | N | Y | 4.96 | 3.26 | 0.8 | 1.2711E7 |  |
 |
7.3395E6 | 1.8201E7 | 1.2593E7 | 2.48 | 1 | 100 | 110 | |
| K.EELTLEGIR.Q | N | Y | 4.94 | 5.21 | 1.1 | 1.231E7 |  |
 |
5.0906E6 | 1.4459E7 | 1.7381E7 | 3.41 | 1 | 239 | 247 | |
| R.DFTVSAMHGDMDQK.E | N | Y | 6.51 | 7.63 | 0.7 | 1.5956E7 |  |
 |
4.4703E6 | 1.9663E7 | 2.3736E7 | 5.31 | 2 | 296 | 309 | |
| K.LNSNTQVVLLSATMPSDVLEVTKK.F | N | Y | 3.34 | 4.47 | 2.4 | 9.5307E6 |  |
 |
2.1427E7 | 2.1747E6 | 4.9905E6 | 9.85 | 1 | 203 | 226 | |
| K.KEELTLEGIR.Q | Y | Y | 5.78 | 2.31 | 0.8 | 3.0112E7 |  |
 |
1.8285E7 | 3.4086E7 | 3.7964E7 | 2.08 | 2 | 238 | 247 | |
| R.GFKDQIYDIFQK.L | N | Y | 6.73 | 1.46 | 0.5 | 1.5098E7 |  |
 |
1.2301E7 | 1.2683E7 | 2.0308E7 | 1.65 | 2 | 191 | 202 | |
| K.LQM(+15.99)EAPHIIVGTPGR.V | N | Y | 7.47 | 1.97 | 0.7 | 4.2928E6 |  |
 |
2.7239E6 | 4.4255E6 | 5.729E6 | 2.10 | 1 | 147 | 161 | Oxidation (M) |
| K.VVMALGDYMGASC(+57.02)HAC(+57.02)IGGTNVR.A | N | Y | 6.21 | 3.99 | 0.9 | 2.8629E6 |  |
 |
1.6744E6 | 4.342E6 | 2.9908E6 | 2.59 | 1 | 119 | 141 | Carbamidomethylation |
| K.GVAINMVTEEDKR.T | N | Y | 7.08 | 0.51 | 1.7 | 1.8038E6 |  |
 |
1.602E6 | 1.8716E6 | 1.9379E6 | 1.21 | 1 | 370 | 382 | |
| K.LNSNTQVVLLSATM(+15.99)PSDVLEVTK.K | N | Y | 4.94 | 5.44 | 1.0 | 1.4365E6 |  |
 |
5.6672E5 | 1.9518E6 | 1.7909E6 | 3.44 | 1 | 203 | 225 | Oxidation (M) |
| total 13 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LQMEAPHIIVGTPGR.V | Y | Y | 7.90 | 2.16 | 0.7 | 5.6057E7 | |
|
3.5464E7 | 6.105E7 | 7.1657E7 | 2.02 | 2 | 152 | 166 | |
| R.KGVAINMVTEEDKR.T | Y | Y | 5.68 | 3.08 | 0.9 | 4.2507E7 | |
|
2.9124E7 | 5.2351E7 | 5.9135E7 | 2.03 | 1 | 374 | 387 | |
| K.DQIYDIFQK.L | N | Y | 4.74 | 6.70 | 0.8 | 1.4812E7 | |
|
3.8301E6 | 2.3469E7 | 1.7136E7 | 6.13 | 1 | 199 | 207 | |
| K.ATQALVLAPTR.E | N | Y | 4.96 | 3.26 | 0.8 | 1.2711E7 | |
|
7.3395E6 | 1.8201E7 | 1.2593E7 | 2.48 | 1 | 105 | 115 | |
| K.EELTLEGIR.Q | N | Y | 4.94 | 5.21 | 1.1 | 1.231E7 | |
|
5.0906E6 | 1.4459E7 | 1.7381E7 | 3.41 | 1 | 244 | 252 | |
| R.DFTVSAMHGDMDQK.E | N | Y | 6.51 | 7.63 | 0.7 | 1.5956E7 | |
|
4.4703E6 | 1.9663E7 | 2.3736E7 | 5.31 | 2 | 301 | 314 | |
| K.LNSNTQVVLLSATMPSDVLEVTKK.F | N | Y | 3.34 | 4.47 | 2.4 | 9.5307E6 | |
|
2.1427E7 | 2.1747E6 | 4.9905E6 | 9.85 | 1 | 208 | 231 | |
| K.KEELTLEGIR.Q | Y | Y | 5.78 | 2.31 | 0.8 | 3.0112E7 | |
|
1.8285E7 | 3.4086E7 | 3.7964E7 | 2.08 | 2 | 243 | 252 | |
| R.GFKDQIYDIFQK.L | N | Y | 6.73 | 1.46 | 0.5 | 1.5098E7 | |
|
1.2301E7 | 1.2683E7 | 2.0308E7 | 1.65 | 2 | 196 | 207 | |
| K.LQM(+15.99)EAPHIIVGTPGR.V | N | Y | 7.47 | 1.97 | 0.7 | 4.2928E6 | |
|
2.7239E6 | 4.4255E6 | 5.729E6 | 2.10 | 1 | 152 | 166 | Oxidation (M) |
| K.VVMALGDYMGASC(+57.02)HAC(+57.02)IGGTNVR.A | N | Y | 6.21 | 3.99 | 0.9 | 2.8629E6 | |
|
1.6744E6 | 4.342E6 | 2.9908E6 | 2.59 | 1 | 124 | 146 | Carbamidomethylation |
| K.GVAINMVTEEDKR.T | N | Y | 7.08 | 0.51 | 1.7 | 1.8038E6 | |
|
1.602E6 | 1.8716E6 | 1.9379E6 | 1.21 | 1 | 375 | 387 | |
| K.LNSNTQVVLLSATM(+15.99)PSDVLEVTK.K | N | Y | 4.94 | 5.44 | 1.0 | 1.4365E6 | |
|
5.6672E5 | 1.9518E6 | 1.7909E6 | 3.44 | 1 | 208 | 230 | Oxidation (M) |
| total 13 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SLSTSGESLYHVLGLDK.N | Y | Y | 6.10 | 3.48 | 4.7 | 1.0248E6 |  |
 |
1.8445E6 | 7.7515E5 | 7.8354E5 | 2.38 | 2 | 8 | 24 | |
| K.EINNAHAILTDATK.R | Y | Y | 9.73 | 3.87 | 1.7 | 1.2434E5 |  |
 |
2.3065E5 | 1.0679E5 | 8.8986E4 | 2.59 | 1 | 59 | 72 | |
| K.APEGEETEFYVSPEDLEAQLQSDER.E | Y | Y | 8.95 | 1.38 | 2.4 | 3.8453E4 |  |
 |
6.5539E4 | 5.4887E4 | 4.1423E4 | 1.58 | 1 | 140 | 164 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SLSTSGESLYHVLGLDK.N | Y | Y | 6.10 | 3.48 | 4.7 | 1.0248E6 | |
|
1.8445E6 | 7.7515E5 | 7.8354E5 | 2.38 | 2 | 8 | 24 | |
| K.EINNAHAILTDATK.R | Y | Y | 9.73 | 3.87 | 1.7 | 1.2434E5 | |
|
2.3065E5 | 1.0679E5 | 8.8986E4 | 2.59 | 1 | 59 | 72 | |
| K.APEGEETEFYVSPEDLEAQLQSDER.G | Y | Y | 8.95 | 1.38 | 2.4 | 3.8453E4 | |
|
6.5539E4 | 5.4887E4 | 4.1423E4 | 1.58 | 1 | 140 | 164 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SLSTSGESLYHVLGLDK.N | Y | Y | 6.10 | 3.48 | 4.7 | 1.0248E6 | |
|
1.8445E6 | 7.7515E5 | 7.8354E5 | 2.38 | 2 | 8 | 24 | |
| K.EINNAHAILTDATK.R | Y | Y | 9.73 | 3.87 | 1.7 | 1.2434E5 | |
|
2.3065E5 | 1.0679E5 | 8.8986E4 | 2.59 | 1 | 59 | 72 | |
| K.APEGEETEFYVSPEDLEAQLQSDER.G | Y | Y | 8.95 | 1.38 | 2.4 | 3.8453E4 | |
|
6.5539E4 | 5.4887E4 | 4.1423E4 | 1.58 | 1 | 140 | 164 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LEALITQTR.A | Y | Y | 4.55 | 4.60 | 0.6 | 3.9584E6 |  |
 |
1.5701E6 | 4.6633E6 | 5.6416E6 | 3.59 | 1 | 254 | 262 | |
| R.FETFC(+57.02)LDPSLVTK.Q | Y | Y | 3.47 | 2.67 | 1.6 | 3.7303E6 |  |
 |
1.4966E6 | 5.2823E6 | 4.412E6 | 3.53 | 1 | 533 | 545 | Carbamidomethylation |
| K.LASAFTEEQAVLYNQR.V | Y | Y | 6.06 | 2.08 | 0.9 | 2.9346E6 |  |
 |
2.1811E6 | 2.9699E6 | 3.6529E6 | 1.67 | 1 | 197 | 212 | |
| K.VSNLQYLHSYLTYIK.L | N | Y | 6.07 | 1.16 | 1.1 | 2.5787E6 |  |
 |
3.0123E6 | 2.3266E6 | 2.3973E6 | 1.29 | 1 | 349 | 363 | |
| R.IFLLGLADNEAAIVQAESEETKER.L | N | Y | 5.16 | 1.13 | 9.0 | 9.899E5 |  |
 |
1.0252E6 | 8.4229E5 | 1.1022E6 | 1.31 | 1 | 288 | 311 | |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LEALITQTR.A | Y | Y | 4.55 | 4.60 | 0.6 | 3.9584E6 | |
|
1.5701E6 | 4.6633E6 | 5.6416E6 | 3.59 | 1 | 277 | 285 | |
| R.FETFC(+57.02)LDPSLVTK.Q | Y | Y | 3.47 | 2.67 | 1.6 | 3.7303E6 | |
|
1.4966E6 | 5.2823E6 | 4.412E6 | 3.53 | 1 | 556 | 568 | Carbamidomethylation |
| K.LASAFTEEQAVLYNQR.V | Y | Y | 6.06 | 2.08 | 0.9 | 2.9346E6 | |
|
2.1811E6 | 2.9699E6 | 3.6529E6 | 1.67 | 1 | 220 | 235 | |
| K.VSNLQYLHSYLTYIK.L | N | Y | 6.07 | 1.16 | 1.1 | 2.5787E6 | |
|
3.0123E6 | 2.3266E6 | 2.3973E6 | 1.29 | 1 | 372 | 386 | |
| R.IFLLGLADNEAAIVQAESEETKER.L | N | Y | 5.16 | 1.13 | 9.0 | 9.899E5 | |
|
1.0252E6 | 8.4229E5 | 1.1022E6 | 1.31 | 1 | 311 | 334 | |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LIDDYGVEEEPAELPEGTSLTVDNKR.F | Y | Y | 9.21 | 10.37 | 0.8 | 1.5698E6 |  |
 |
3.5258E6 | 3.3885E5 | 8.4484E5 | 10.41 | 1 | 204 | 229 | |
| R.GPGLGSTQGQTIALPAQGLIEFR.D | Y | Y | 7.34 | 3.12 | 1.1 | 1.5077E6 |  |
 |
2.7572E6 | 8.769E5 | 8.8904E5 | 3.14 | 1 | 176 | 198 | |
| R.FFFDVGSNK.Y | Y | Y | 5.23 | 0.08 | 1.0 | 1.1901E6 |  |
 |
1.1802E6 | 1.1747E6 | 1.2154E6 | 1.03 | 1 | 230 | 238 | |
| K.LIDDYGVEEEPAELPEGTSLTVDNK.R | N | Y | 13.84 | 7.16 | 1.4 | 5.2332E5 |  |
 |
1.0513E6 | 2.8404E5 | 2.3461E5 | 4.48 | 1 | 204 | 228 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VQESADELQK.M | Y | Y | 4.73 | 1.99 | 1.0 | 3.6716E6 |  |
 |
5.3399E6 | 2.6746E6 | 3.6691E6 | 2.00 | 1 | 100 | 109 | |
| K.QDMPNAMPVSELTDK.L | Y | Y | 7.74 | 6.89 | 11.5 | 1.1126E6 |  |
 |
2.1841E6 | 4.7424E5 | 6.7945E5 | 4.61 | 1 | 128 | 142 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VQESADELQK.M | Y | Y | 4.73 | 1.99 | 1.0 | 3.6716E6 | |
|
5.3399E6 | 2.6746E6 | 3.6691E6 | 2.00 | 1 | 100 | 109 | |
| K.QDMPNAMPVSELTDK.L | Y | Y | 7.74 | 6.89 | 11.5 | 1.1126E6 | |
|
2.1841E6 | 4.7424E5 | 6.7945E5 | 4.61 | 1 | 128 | 142 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LTVEQAVLLSR.L | Y | Y | 6.28 | 4.20 | 0.7 | 1.2957E6 | |
|
5.7892E5 | 1.5413E6 | 1.7669E6 | 3.05 | 1 | 237 | 247 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LTVEQAVLLSR.L | Y | Y | 6.28 | 4.20 | 0.7 | 1.2957E6 | |
|
5.7892E5 | 1.5413E6 | 1.7669E6 | 3.05 | 1 | 237 | 247 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.AALVDLEPGTMDSVR.S | Y | Y | 3.62 | 3.08 | 6.8 | 5.0792E6 | |
|
8.5725E6 | 1.8479E6 | 4.8172E6 | 4.64 | 1 | 63 | 77 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SEREDEVLLVSSSR.Y | Y | Y | 6.05 | 3.66 | 1.5 | 1.9521E6 |  |
 |
3.4774E6 | 1.4851E6 | 1.2652E6 | 2.75 | 1 | 27 | 40 | |
| K.VLQC(+57.02)HKPVHAEYLEK.L | Y | Y | 4.95 | 3.79 | 0.6 | 1.8161E6 |  |
 |
3.0648E6 | 1.2069E6 | 1.4785E6 | 2.54 | 1 | 128 | 142 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LSPPYSSPQEFAQDVGR.M | Y | Y | 6.58 | 1.69 | 0.4 | 1.7192E7 |  |
 |
1.0624E7 | 1.9789E7 | 2.1163E7 | 1.99 | 1 | 752 | 768 | |
| K.ADVQSIIGLQR.F | Y | Y | 4.97 | 2.99 | 0.8 | 1.2962E7 |  |
 |
6.9256E6 | 1.535E7 | 1.661E7 | 2.40 | 1 | 781 | 791 | |
| R.FASWALESDNNTALLLSK.K | Y | Y | 4.86 | 4.10 | 0.7 | 1.0811E7 |  |
 |
5.8281E6 | 1.5126E7 | 1.148E7 | 2.60 | 1 | 350 | 367 | |
| K.HEPLVLFC(+57.02)ESC(+57.02)DTLTC(+57.02)R.D | N | Y | 5.50 | 7.06 | 0.5 | 8.6811E6 |  |
|
2.5403E6 | 1.1301E7 | 1.2202E7 | 4.80 | 1 | 216 | 232 | Carbamidomethylation |
| K.MIVDPVEPHGEMK.F | N | Y | 5.24 | 3.65 | 0.8 | 7.8749E6 |  |
|
3.8298E6 | 9.0042E6 | 1.0791E7 | 2.82 | 1 | 380 | 392 | |
| R.SGEGEVSGLMR.K | N | Y | 4.67 | 6.95 | 1.2 | 6.3524E6 |  |
 |
2.7928E6 | 6.0316E6 | 1.0233E7 | 3.66 | 1 | 474 | 484 | |
| K.VFPGSTTEDYNLIVIER.G | N | Y | 4.72 | 2.96 | 1.0 | 6.2234E6 |  |
 |
3.1153E6 | 8.3592E6 | 7.1958E6 | 2.68 | 1 | 509 | 525 | |
| K.EEDGSLSLDGADSTGVVAK.L | N | Y | 5.28 | 4.49 | 1.0 | 4.3501E6 |  |
 |
2.0444E6 | 5.3334E6 | 5.6725E6 | 2.77 | 1 | 678 | 696 | |
| K.DHQYQFLEDAVR.N | N | Y | 6.36 | 5.52 | 3.2 | 8.5036E6 |  |
 |
2.5956E6 | 1.2227E7 | 1.0688E7 | 4.71 | 2 | 241 | 252 | |
| K.MAILQIMK.E | N | Y | 4.78 | 7.95 | 0.5 | 2.1697E6 |  |
 |
6.0627E5 | 2.6699E6 | 3.2329E6 | 5.33 | 1 | 299 | 306 | |
| total 10 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ASAAFSSVGSVITK.K | Y | Y | 4.16 | 3.43 | 8.2 | 5.2132E6 |  |
 |
7.0755E6 | 1.977E6 | 6.587E6 | 3.58 | 1 | 110 | 123 | |
| K.VEEEIQTLSQVLAAK.E | Y | Y | 5.14 | 2.01 | 0.6 | 4.3255E6 |  |
|
6.4156E6 | 3.1469E6 | 3.4141E6 | 2.04 | 1 | 46 | 60 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ASAAFSSVGSVITK.K | Y | Y | 4.16 | 3.43 | 8.2 | 5.2132E6 | |
|
7.0755E6 | 1.977E6 | 6.587E6 | 3.58 | 1 | 149 | 162 | |
| K.VEEEIQTLSQVLAAK.E | Y | Y | 5.14 | 2.01 | 0.6 | 4.3255E6 | |
|
6.4156E6 | 3.1469E6 | 3.4141E6 | 2.04 | 1 | 85 | 99 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SLGTADVHFER.K | Y | Y | 4.53 | 2.65 | 1.2 | 2.417E7 |  |
 |
1.4869E7 | 3.4286E7 | 3.5112E7 | 2.36 | 2 | 145 | 155 | |
| K.WQHDLFDSGFGGGAGVETGGK.L | Y | Y | 6.66 | 3.97 | 0.6 | 1.4826E7 |  |
 |
7.7855E6 | 2.0954E7 | 1.5823E7 | 2.69 | 2 | 87 | 107 | |
| K.MDMSLDDIIK.L | N | Y | 4.26 | 2.80 | 1.0 | 3.8594E6 |  |
 |
1.6456E6 | 5.228E6 | 4.7045E6 | 3.18 | 1 | 5 | 14 | |
| K.QQLSAEELDAQLDAYNAR.M | Y | Y | 6.36 | 2.99 | 0.8 | 1.3808E7 |  |
 |
6.9039E6 | 1.7154E7 | 1.7365E7 | 2.52 | 2 | 235 | 252 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VFSANSTAAC(+57.02)TELAK.R | Y | Y | 5.17 | 2.21 | 1.7 | 2.7007E6 |  |
 |
4.1126E6 | 2.0543E6 | 1.9351E6 | 2.13 | 1 | 10 | 24 | Carbamidomethylation |
| R.GQDIFIIQTIPR.D | Y | Y | 5.33 | 6.89 | 4.1 | 1.5777E6 |  |
 |
3.1768E6 | 8.1272E5 | 7.4349E5 | 4.27 | 1 | 57 | 68 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VFSANSTAAC(+57.02)TELAK.R | Y | Y | 5.17 | 2.21 | 1.7 | 2.7007E6 | |
|
4.1126E6 | 2.0543E6 | 1.9351E6 | 2.13 | 1 | 39 | 53 | Carbamidomethylation |
| R.GQDIFIIQTIPR.D | Y | Y | 5.33 | 6.89 | 4.1 | 1.5777E6 | |
|
3.1768E6 | 8.1272E5 | 7.4349E5 | 4.27 | 1 | 86 | 97 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.DVLEVGELAK.L | Y | Y | 4.75 | 9.14 | 2.5 | 4.0596E6 |  |
 |
1.1532E6 | 5.2343E6 | 5.7913E6 | 5.02 | 1 | 59 | 68 | |
| K.MLNHVLNIC(+57.02)EK.D | Y | Y | 4.09 | 5.16 | 1.9 | 3.3127E6 |  |
 |
1.3094E6 | 3.6326E6 | 4.9961E6 | 3.82 | 1 | 113 | 123 | Carbamidomethylation |
| R.LNQVIFPVSYNDK.F | Y | Y | 6.40 | 1.11 | 0.5 | 3.2781E6 |  |
 |
2.6963E6 | 3.402E6 | 3.736E6 | 1.39 | 1 | 43 | 55 | |
| K.LAYFNDIAVGAVC(+57.02)C(+57.02)R.V | N | Y | 5.64 | 2.59 | 0.4 | 2.5995E6 |  |
 |
1.6665E6 | 2.6181E6 | 3.514E6 | 2.11 | 1 | 69 | 83 | Carbamidomethylation |
| K.RIEPADAHVLQK.S | N | Y | 6.77 | 0.91 | 1.1 | 2.5776E6 |  |
 |
2.4485E6 | 2.5526E6 | 3.37E6 | 1.38 | 1 | 162 | 173 | |
| R.IELGDVTPHNIK.Q | N | Y | 7.31 | 1.43 | 0.5 | 2.5072E6 |  |
 |
2.1856E6 | 1.9629E6 | 3.3733E6 | 1.72 | 1 | 27 | 38 | |
| K.FGFEIIETK.K | N | Y | 5.47 | 0.07 | 0.3 | 1.3968E6 |  |
 |
1.4123E6 | 1.3738E6 | 1.4044E6 | 1.03 | 1 | 148 | 156 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.DVLEVGELAK.L | Y | Y | 4.75 | 9.14 | 2.5 | 4.0596E6 | |
|
1.1532E6 | 5.2343E6 | 5.7913E6 | 5.02 | 1 | 36 | 45 | |
| K.MLNHVLNIC(+57.02)EK.D | Y | Y | 4.09 | 5.16 | 1.9 | 3.3127E6 | |
|
1.3094E6 | 3.6326E6 | 4.9961E6 | 3.82 | 1 | 90 | 100 | Carbamidomethylation |
| R.LNQVIFPVSYNDK.F | Y | Y | 6.40 | 1.11 | 0.5 | 3.2781E6 | |
|
2.6963E6 | 3.402E6 | 3.736E6 | 1.39 | 1 | 20 | 32 | |
| K.LAYFNDIAVGAVC(+57.02)C(+57.02)R.V | N | Y | 5.64 | 2.59 | 0.4 | 2.5995E6 | |
|
1.6665E6 | 2.6181E6 | 3.514E6 | 2.11 | 1 | 46 | 60 | Carbamidomethylation |
| K.RIEPADAHVLQK.S | N | Y | 6.77 | 0.91 | 1.1 | 2.5776E6 | |
|
2.4485E6 | 2.5526E6 | 3.37E6 | 1.38 | 1 | 139 | 150 | |
| R.IELGDVTPHNIK.Q | N | Y | 7.31 | 1.43 | 0.5 | 2.5072E6 | |
|
2.1856E6 | 1.9629E6 | 3.3733E6 | 1.72 | 1 | 4 | 15 | |
| K.FGFEIIETK.K | N | Y | 5.47 | 0.07 | 0.3 | 1.3968E6 | |
|
1.4123E6 | 1.3738E6 | 1.4044E6 | 1.03 | 1 | 125 | 133 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.DVLEVGELAK.L | Y | Y | 4.75 | 9.14 | 2.5 | 4.0596E6 | |
|
1.1532E6 | 5.2343E6 | 5.7913E6 | 5.02 | 1 | 37 | 46 | |
| K.MLNHVLNIC(+57.02)EK.D | Y | Y | 4.09 | 5.16 | 1.9 | 3.3127E6 | |
|
1.3094E6 | 3.6326E6 | 4.9961E6 | 3.82 | 1 | 91 | 101 | Carbamidomethylation |
| R.LNQVIFPVSYNDK.F | Y | Y | 6.40 | 1.11 | 0.5 | 3.2781E6 | |
|
2.6963E6 | 3.402E6 | 3.736E6 | 1.39 | 1 | 21 | 33 | |
| K.LAYFNDIAVGAVC(+57.02)C(+57.02)R.V | N | Y | 5.64 | 2.59 | 0.4 | 2.5995E6 | |
|
1.6665E6 | 2.6181E6 | 3.514E6 | 2.11 | 1 | 47 | 61 | Carbamidomethylation |
| K.RIEPADAHVLQK.S | N | Y | 6.77 | 0.91 | 1.1 | 2.5776E6 | |
|
2.4485E6 | 2.5526E6 | 3.37E6 | 1.38 | 1 | 140 | 151 | |
| R.IELGDVTPHNIK.Q | N | Y | 7.31 | 1.43 | 0.5 | 2.5072E6 | |
|
2.1856E6 | 1.9629E6 | 3.3733E6 | 1.72 | 1 | 5 | 16 | |
| K.FGFEIIETK.K | N | Y | 5.47 | 0.07 | 0.3 | 1.3968E6 | |
|
1.4123E6 | 1.3738E6 | 1.4044E6 | 1.03 | 1 | 126 | 134 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.DVLEVGELAK.L | Y | Y | 4.75 | 9.14 | 2.5 | 4.0596E6 | |
|
1.1532E6 | 5.2343E6 | 5.7913E6 | 5.02 | 1 | 42 | 51 | |
| K.MLNHVLNIC(+57.02)EK.D | Y | Y | 4.09 | 5.16 | 1.9 | 3.3127E6 | |
|
1.3094E6 | 3.6326E6 | 4.9961E6 | 3.82 | 1 | 96 | 106 | Carbamidomethylation |
| R.LNQVIFPVSYNDK.F | Y | Y | 6.40 | 1.11 | 0.5 | 3.2781E6 | |
|
2.6963E6 | 3.402E6 | 3.736E6 | 1.39 | 1 | 26 | 38 | |
| K.LAYFNDIAVGAVC(+57.02)C(+57.02)R.V | N | Y | 5.64 | 2.59 | 0.4 | 2.5995E6 | |
|
1.6665E6 | 2.6181E6 | 3.514E6 | 2.11 | 1 | 52 | 66 | Carbamidomethylation |
| K.RIEPADAHVLQK.S | N | Y | 6.77 | 0.91 | 1.1 | 2.5776E6 | |
|
2.4485E6 | 2.5526E6 | 3.37E6 | 1.38 | 1 | 145 | 156 | |
| R.IELGDVTPHNIK.Q | N | Y | 7.31 | 1.43 | 0.5 | 2.5072E6 | |
|
2.1856E6 | 1.9629E6 | 3.3733E6 | 1.72 | 1 | 10 | 21 | |
| K.FGFEIIETK.K | N | Y | 5.47 | 0.07 | 0.3 | 1.3968E6 | |
|
1.4123E6 | 1.3738E6 | 1.4044E6 | 1.03 | 1 | 131 | 139 | |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.YPMAVGLNK.G | Y | Y | 4.87 | 3.35 | 3.4 | 3.923E7 |  |
 |
2.2205E7 | 4.3634E7 | 5.1853E7 | 2.34 | 1 | 5 | 13 | |
| R.EVC(+57.02)GFAPYER.R | Y | Y | 5.05 | 14.38 | 2.6 | 2.4524E7 |  |
 |
2.8251E6 | 3.4123E7 | 3.6624E7 | 12.96 | 1 | 47 | 56 | Carbamidomethylation |
| R.KREELSNVLAAMR.K | Y | Y | 7.15 | 1.05 | 0.4 | 9.4386E6 |  |
 |
7.9766E6 | 8.5736E6 | 1.1766E7 | 1.48 | 1 | 87 | 99 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IGDYVQQHGGVSLVEQLLQDPK.L | Y | Y | 4.32 | 1.97 | 0.6 | 6.727E6 |  |
 |
1.1409E7 | 4.7602E6 | 4.0124E6 | 2.84 | 1 | 260 | 281 | |
| R.TTETQVLVASAQK.K | Y | Y | 7.32 | 1.55 | 0.6 | 5.0352E6 |  |
 |
6.9922E6 | 3.5287E6 | 4.5848E6 | 1.98 | 1 | 399 | 411 | |
| R.HGAEVIDTPVFELK.E | Y | Y | 5.95 | 3.43 | 0.6 | 3.5071E6 |  |
 |
5.0859E6 | 2.1292E6 | 4.273E6 | 2.39 | 2 | 87 | 100 | |
| R.YDGLVGMFDPK.G | N | Y | 4.53 | 1.29 | 1.3 | 1.5236E6 |  |
 |
1.2262E6 | 1.4021E6 | 1.9424E6 | 1.58 | 1 | 356 | 366 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VEESSWLIEDGK.V | Y | Y | 4.42 | 1.72 | 0.6 | 1.6041E7 |  |
 |
1.0289E7 | 1.7578E7 | 2.0255E7 | 1.97 | 1 | 229 | 240 | |
| K.LSDLDSETR.S | Y | Y | 4.57 | 2.79 | 0.6 | 7.4242E6 |  |
 |
3.4093E6 | 1.0865E7 | 1.0715E7 | 3.19 | 1 | 277 | 285 | |
| K.TDFFIGGEEGMAEK.L | Y | Y | 5.61 | 8.11 | 0.6 | 4.3389E6 |  |
|
1.7864E6 | 6.1271E6 | 5.1033E6 | 3.43 | 1 | 40 | 53 | |
| K.ELTDEEAER.L | N | Y | 4.80 | 6.72 | 1.7 | 3.5645E6 |  |
 |
1.139E6 | 5.4465E6 | 5.4697E6 | 4.80 | 1 | 106 | 114 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VEESSWLIEDGK.V | Y | Y | 4.42 | 1.72 | 0.6 | 1.6041E7 | |
|
1.0289E7 | 1.7578E7 | 2.0255E7 | 1.97 | 1 | 213 | 224 | |
| K.LSDLDSETR.S | Y | Y | 4.57 | 2.79 | 0.6 | 7.4242E6 | |
|
3.4093E6 | 1.0865E7 | 1.0715E7 | 3.19 | 1 | 261 | 269 | |
| K.TDFFIGGEEGMAEK.L | Y | Y | 5.61 | 8.11 | 0.6 | 4.3389E6 | |
|
1.7864E6 | 6.1271E6 | 5.1033E6 | 3.43 | 1 | 24 | 37 | |
| K.ELTDEEAER.L | N | Y | 4.80 | 6.72 | 1.7 | 3.5645E6 | |
|
1.139E6 | 5.4465E6 | 5.4697E6 | 4.80 | 1 | 90 | 98 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VITEYLNAQESAK.S | Y | Y | 5.99 | 4.00 | 0.8 | 1.6461E7 |  |
 |
2.6882E7 | 8.2713E6 | 1.4229E7 | 3.25 | 1 | 873 | 885 | |
| K.VWAHYEEQPVEEVMPVLEEK.E | Y | Y | 5.29 | 2.23 | 1.3 | 8.2044E6 |  |
 |
9.7738E6 | 5.2111E6 | 9.7275E6 | 1.88 | 2 | 656 | 675 | |
| K.VMQVLNADAIVVK.L | Y | Y | 3.36 | 0.53 | 0.4 | 7.1611E6 |  |
 |
1.2027E7 | 8.4053E6 | 1.1267E7 | 1.43 | 1 | 346 | 358 | |
| R.TDAVDSVVR.D | N | Y | 2.63 | 1.18 | 3.6 | 4.5447E6 |  |
|
7.1399E6 | 2.4126E6 | 4.6846E6 | 2.96 | 1 | 810 | 818 | |
| K.DTPDEPWAFPAR.E | N | Y | 5.33 | 5.35 | 0.5 | 3.804E6 |  |
 |
2E6 | 3.7578E6 | 5.6543E6 | 2.83 | 1 | 71 | 82 | |
| R.ADDADEFGYSR | N | Y | 5.48 | 1.96 | 0.9 | 3.577E6 |  |
 |
3.1805E6 | 3.1761E6 | 5.1683E6 | 1.63 | 1 | 899 | 909 | |
| K.GDVGLGLVK.E | N | Y | 3.82 | 0.79 | 5.3 | 3.3301E6 |  |
 |
4.245E6 | 2.7246E6 | 4.0277E6 | 1.56 | 1 | 848 | 856 | |
| K.QFLPFLQR.A | N | Y | 5.17 | 1.87 | 0.5 | 2.1306E6 |  |
 |
2.6054E6 | 1.3262E6 | 2.4602E6 | 1.96 | 1 | 515 | 522 | |
| K.MVLSGC(+57.02)AIIVR.G | N | Y | 6.69 | 1.12 | 2.3 | 1.4231E6 |  |
 |
1.2478E6 | 1.2122E6 | 1.8094E6 | 1.49 | 1 | 25 | 35 | Carbamidomethylation |
| total 9 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.GPVYIGELPQDFLR.I | Y | Y | 4.34 | 5.35 | 3.2 | 1.5927E6 | |
|
3.3077E6 | 8.2421E5 | 6.4629E5 | 5.12 | 1 | 10 | 23 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.GPVYIGELPQDFLR.I | Y | Y | 4.34 | 5.35 | 3.2 | 1.5927E6 | |
|
3.3077E6 | 8.2421E5 | 6.4629E5 | 5.12 | 1 | 10 | 23 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.AILPC(+57.02)QDTPSVK.L | Y | Y | 6.55 | 2.38 | 0.4 | 8.999E6 |  |
 |
5.7403E6 | 9.274E6 | 1.1983E7 | 2.09 | 1 | 143 | 154 | Carbamidomethylation |
| K.LTYTAEVSVPK.E | Y | Y | 4.78 | 6.66 | 4.0 | 7.1565E6 |  |
|
2.3418E6 | 8.2971E6 | 1.0831E7 | 4.63 | 1 | 155 | 165 | |
| K.SLSNVIAHEISHSWTGNLVTNK.T | Y | Y | 6.68 | 0.93 | 0.5 | 6.6827E6 |  |
 |
5.8822E6 | 6.1839E6 | 7.9819E6 | 1.36 | 1 | 289 | 310 | |
| K.SAYEFSETESMLK.I | N | Y | 7.85 | 2.44 | 0.7 | 4.7794E6 |  |
 |
2.9942E6 | 5.1552E6 | 6.1888E6 | 2.07 | 1 | 231 | 243 | |
| K.GSPMEISLPIALSK.N | N | Y | 5.80 | 1.58 | 0.5 | 3.1292E6 |  |
 |
2.4667E6 | 3.1541E6 | 3.7668E6 | 1.53 | 1 | 84 | 97 | |
| R.MQEVYNFNAINNSEIR.F | N | Y | 7.70 | 2.08 | 1.4 | 2.3594E6 |  |
 |
1.4455E6 | 2.5374E6 | 3.0952E6 | 2.14 | 1 | 521 | 536 | |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.FQYC(+57.02)VAVGAQTFPSVSAPSK.K | Y | Y | 7.49 | 16.50 | 0.7 | 7.7742E5 | |
|
5.4168E4 | 1.0005E6 | 1.2911E6 | 23.83 | 1 | 596 | 615 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M.A(+42.01)ETLSGLGDSGAASAAAVSSAASETGTR.R | Y | Y | 10.51 | 3.34 | 1.5 | 4.511E5 | |
|
2.3076E5 | 6.6845E5 | 5.6949E5 | 2.90 | 1 | 2 | 29 | Acetylation (N-term) |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NPEPELLVR.W | Y | Y | 5.53 | 2.72 | 1.3 | 1.6636E7 |  |
 |
9.6617E6 | 1.8639E7 | 2.1609E7 | 2.24 | 1 | 507 | 515 | |
| R.FGAVWTGDNTAEWDHLK.I | Y | Y | 6.92 | 1.67 | 0.7 | 1.4158E7 |  |
 |
1.0237E7 | 1.4529E7 | 1.7708E7 | 1.73 | 2 | 464 | 480 | |
| K.AEKDEPGAWEETFK.T | Y | Y | 6.92 | 2.65 | 0.9 | 1.0161E7 |  |
 |
6.1196E6 | 1.1174E7 | 1.3449E7 | 2.20 | 2 | 71 | 84 | |
| K.HHGPQTLYLPVTLSSIPVFQR.G | N | Y | 5.46 | 0.37 | 0.6 | 4.9201E6 |  |
 |
4.5006E6 | 5.1118E6 | 5.1478E6 | 1.14 | 1 | 638 | 658 | |
| K.LVAIVDPHIK.V | N | Y | 5.64 | 2.71 | 0.5 | 4.1249E6 |  |
 |
2.6401E6 | 4.1707E6 | 5.5639E6 | 2.11 | 1 | 316 | 325 | |
| R.KLVAIVDPHIK.V | N | Y | 7.20 | 2.18 | 0.5 | 1.7679E6 |  |
 |
1.1862E6 | 1.7264E6 | 2.391E6 | 2.02 | 1 | 315 | 325 | |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NPEPELLVR.W | Y | Y | 5.53 | 2.72 | 1.3 | 1.6636E7 | |
|
9.6617E6 | 1.8639E7 | 2.1609E7 | 2.24 | 1 | 481 | 489 | |
| R.FGAVWTGDNTAEWDHLK.I | Y | Y | 6.92 | 1.67 | 0.7 | 1.4158E7 | |
|
1.0237E7 | 1.4529E7 | 1.7708E7 | 1.73 | 2 | 438 | 454 | |
| K.AEKDEPGAWEETFK.T | Y | Y | 6.92 | 2.65 | 0.9 | 1.0161E7 | |
|
6.1196E6 | 1.1174E7 | 1.3449E7 | 2.20 | 2 | 45 | 58 | |
| K.HHGPQTLYLPVTLSSIPVFQR.G | N | Y | 5.46 | 0.37 | 0.6 | 4.9201E6 | |
|
4.5006E6 | 5.1118E6 | 5.1478E6 | 1.14 | 1 | 612 | 632 | |
| K.LVAIVDPHIK.V | N | Y | 5.64 | 2.71 | 0.5 | 4.1249E6 | |
|
2.6401E6 | 4.1707E6 | 5.5639E6 | 2.11 | 1 | 290 | 299 | |
| R.KLVAIVDPHIK.V | N | Y | 7.20 | 2.18 | 0.5 | 1.7679E6 | |
|
1.1862E6 | 1.7264E6 | 2.391E6 | 2.02 | 1 | 289 | 299 | |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.TTVGVDGSLYK.M | Y | Y | 3.87 | 1.84 | 2.6 | 3.3222E6 |  |
 |
5.1626E6 | 2.8553E6 | 1.9488E6 | 2.65 | 1 | 464 | 474 | |
| K.FNTSDVSAIEK.D | Y | Y | 4.21 | 3.25 | 0.8 | 2.7729E6 |  |
 |
4.1936E6 | 2.8272E6 | 1.2978E6 | 3.23 | 1 | 390 | 400 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ITAEEMYDIFGK.Y | Y | Y | 4.71 | 2.44 | 0.5 | 4.8133E6 |  |
 |
2.5012E6 | 5.9128E6 | 6.0258E6 | 2.41 | 1 | 30 | 41 | |
| R.GTAYVVYEDIFDAK.N | Y | Y | 5.69 | 4.93 | 0.5 | 4.1265E6 |  |
 |
2.1015E6 | 5.2445E6 | 5.0335E6 | 2.50 | 1 | 58 | 71 | |
| K.NAC(+57.02)DHLSGFNVC(+57.02)NR.Y | Y | Y | 13.51 | 3.10 | 1.1 | 3.4719E5 |  |
 |
2.0945E5 | 4.8536E5 | 5.2044E5 | 2.48 | 1 | 72 | 85 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ITAEEMYDIFGK.Y | Y | Y | 4.71 | 2.44 | 0.5 | 4.8133E6 | |
|
2.5012E6 | 5.9128E6 | 6.0258E6 | 2.41 | 1 | 29 | 40 | |
| R.GTAYVVYEDIFDAK.N | Y | Y | 5.69 | 4.93 | 0.5 | 4.1265E6 | |
|
2.1015E6 | 5.2445E6 | 5.0335E6 | 2.50 | 1 | 57 | 70 | |
| K.NAC(+57.02)DHLSGFNVC(+57.02)NR.Y | Y | Y | 13.51 | 3.10 | 1.1 | 3.4719E5 | |
|
2.0945E5 | 4.8536E5 | 5.2044E5 | 2.48 | 1 | 71 | 84 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LSQLEGVNVER.Y | Y | Y | 5.59 | 5.15 | 0.4 | 6.2886E6 |  |
|
1.1589E7 | 3.4123E6 | 3.8642E6 | 3.40 | 1 | 227 | 237 | |
| K.IREDLPNLESSEETEQINK.H | Y | Y | 9.67 | 3.07 | 0.9 | 5.8415E6 |  |
 |
9.4572E6 | 3.6671E6 | 4.4419E6 | 2.58 | 2 | 750 | 768 | |
| K.LLDEAIQAVK.V | Y | Y | 4.87 | 3.97 | 0.8 | 5.6064E6 |  |
 |
8.9764E6 | 3.6346E6 | 4.2081E6 | 2.47 | 1 | 15 | 24 | |
| R.SEDPDQQYLILNTAR.K | N | Y | 8.09 | 2.93 | 1.0 | 5.1956E6 |  |
 |
8.5086E6 | 3.6283E6 | 3.4498E6 | 2.47 | 1 | 500 | 514 | |
| K.VLETTVEIFNK.L | N | Y | 4.74 | 3.91 | 1.0 | 3.9871E6 |  |
 |
6.9463E6 | 2.479E6 | 2.536E6 | 2.80 | 1 | 372 | 382 | |
| K.IPVDTYNNILTVLK.L | N | Y | 5.51 | 5.66 | 0.5 | 3.4624E6 |  |
 |
6.1605E6 | 2.7501E6 | 1.4767E6 | 4.17 | 1 | 404 | 417 | |
| R.ILVGTNLVR.L | N | Y | 6.84 | 4.59 | 0.4 | 2.9097E6 |  |
 |
5.5635E6 | 1.3681E6 | 1.7975E6 | 4.07 | 1 | 218 | 226 | |
| K.LNLEHIATSSAVSK.E | N | Y | 6.93 | 4.20 | 4.0 | 4.1825E6 |  |
 |
7.1237E6 | 2.8282E6 | 2.5956E6 | 2.74 | 2 | 383 | 396 | |
| total 8 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.EIADGLC(+57.02)LEVEGK.M | Y | Y | 5.36 | 3.75 | 0.7 | 2.3119E7 | |
|
3.4705E7 | 1.8536E7 | 1.6115E7 | 2.15 | 1 | 22 | 34 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.EIADGLC(+57.02)LEVEGK.M | Y | Y | 5.36 | 3.75 | 0.7 | 2.3119E7 | |
|
3.4705E7 | 1.8536E7 | 1.6115E7 | 2.15 | 1 | 22 | 34 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SHSSAQFLIGDQEPWAFR.G | Y | Y | 7.92 | 2.23 | 0.7 | 8.5345E5 | |
|
1.2249E6 | 5.9304E5 | 7.4244E5 | 2.07 | 1 | 697 | 714 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.GLGSTVQEIDLTGVK.L | Y | Y | 6.79 | 5.64 | 0.6 | 6.2357E6 |  |
 |
1.1391E7 | 3.5103E6 | 3.8054E6 | 3.25 | 1 | 162 | 176 | |
| K.ASAPESGLLSK.V | Y | Y | 4.99 | 1.83 | 0.8 | 5.0384E6 |  |
 |
7.5985E6 | 3.8787E6 | 4.6076E6 | 1.96 | 1 | 286 | 296 | |
| K.YFGDIISVGQR.L | Y | Y | 5.85 | 1.20 | 0.5 | 2.6242E6 |  |
|
3.2592E6 | 2.1721E6 | 2.4412E6 | 1.50 | 1 | 131 | 141 | |
| R.TGIIVTTSEAVLLQLVADKDHPK.F | N | Y | 4.89 | 7.26 | 0.9 | 1.3014E6 |  |
 |
2.9667E6 | 5.1327E5 | 4.2433E5 | 6.99 | 1 | 254 | 276 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.WDYLTQVEK.E | Y | Y | 5.53 | 3.01 | 0.5 | 1.4573E7 |  |
 |
9.4202E6 | 1.3924E7 | 2.0375E7 | 2.16 | 1 | 164 | 172 | |
| K.TDTVIILC(+57.02)R.K | Y | Y | 5.00 | 3.07 | 0.7 | 1.2067E7 |  |
 |
6.1865E6 | 1.1988E7 | 1.8026E7 | 2.91 | 1 | 148 | 156 | Carbamidomethylation |
| K.ISNYGWDQSDK.F | Y | Y | 5.33 | 1.81 | 0.5 | 1.09E7 |  |
 |
8.8063E6 | 9.6658E6 | 1.4227E7 | 1.62 | 1 | 76 | 86 | |
| R.SFDLLVK.N | N | Y | 5.00 | 1.86 | 0.5 | 8.8347E6 |  |
 |
6.5228E6 | 7.3827E6 | 1.2599E7 | 1.93 | 1 | 113 | 119 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IVPGQFLAVDPK.G | Y | Y | 4.82 | 1.96 | 0.3 | 8.5236E6 |  |
 |
5.5379E6 | 1.0347E7 | 9.6856E6 | 1.87 | 1 | 115 | 126 | |
| K.HIANYISGIQTIGHR.V | Y | Y | 4.91 | 3.25 | 0.6 | 7.6082E6 |  |
 |
3.3244E6 | 8.8909E6 | 1.0609E7 | 3.19 | 1 | 985 | 999 | |
| R.IVILEYQPSK.N | N | Y | 4.84 | 3.25 | 0.6 | 7.1112E6 |  |
 |
3.8697E6 | 8.5009E6 | 8.9629E6 | 2.32 | 1 | 87 | 96 | |
| R.SVAGGFVYTYK.L | N | Y | 5.57 | 3.65 | 0.6 | 6.4576E6 |  |
 |
3.3903E6 | 7.7581E6 | 8.2244E6 | 2.43 | 1 | 919 | 929 | |
| R.LPPNTNDEVDEDPTGNK.A | N | Y | 5.35 | 3.37 | 0.9 | 6.1427E6 |  |
 |
3.394E6 | 8.4382E6 | 8.7056E6 | 2.57 | 1 | 1058 | 1074 | |
| K.ITLETDEDMVTEIR.L | N | Y | 4.64 | 2.88 | 0.6 | 5.8588E6 |  |
 |
3.042E6 | 6.7251E6 | 7.8093E6 | 2.57 | 1 | 313 | 326 | |
| K.FGNIC(+57.02)VVR.L | N | Y | 5.11 | 5.29 | 0.6 | 5.4547E6 |  |
 |
2.4326E6 | 6.2334E6 | 7.6981E6 | 3.16 | 1 | 1050 | 1057 | Carbamidomethylation |
| K.NFGDQPDIR.C | N | Y | 3.38 | 2.78 | 0.9 | 5.4092E6 |  |
 |
1.6541E6 | 6.7922E6 | 9.4794E6 | 5.73 | 1 | 260 | 268 | |
| R.WVTTASLLDYDTVAGADK.F | N | Y | 6.09 | 3.06 | 1.3 | 4.8918E6 |  |
|
3.2167E6 | 5.9419E6 | 5.5168E6 | 1.85 | 1 | 1032 | 1049 | |
| K.LGAVFNQVAFPLQYTPR.K | N | Y | 5.63 | 4.58 | 1.0 | 4.0376E6 |  |
 |
2.5248E6 | 7.4294E6 | 4.3172E6 | 2.94 | 1 | 770 | 786 | |
| R.HGLEVSEMAVSELPGNPNAVWTVR.R | N | Y | 5.04 | 3.74 | 0.7 | 3.6537E6 |  |
 |
2.1601E6 | 5.567E6 | 6.4681E6 | 2.99 | 1 | 440 | 463 | |
| K.NVIDGDLC(+57.02)EQFNSMEPNK.Q | N | Y | 6.26 | 8.92 | 0.6 | 3.0073E6 |  |
 |
1.1385E6 | 3.6105E6 | 4.273E6 | 3.75 | 1 | 1172 | 1189 | Carbamidomethylation |
| K.TPVEEVPAAIAPFQGR.V | Y | Y | 5.72 | 2.29 | 1.9 | 8.4691E6 |  |
 |
5.5426E6 | 8.7863E6 | 1.1078E7 | 2.00 | 2 | 943 | 958 | |
| R.KQQMAEEMVEAAGEDER.E | N | Y | 11.91 | 4.95 | 0.9 | 8.1601E5 |  |
 |
3.2174E5 | 1.1748E6 | 9.5151E5 | 3.65 | 1 | 816 | 832 | |
| R.NENQLIIFADDTYPR.W | N | Y | 5.69 | 4.52 | 1.7 | 2.7941E6 |  |
 |
1.3335E6 | 3.7248E6 | 3.4993E6 | 2.79 | 2 | 1017 | 1031 | |
| K.ITLETDEDM(+15.99)VTEIR.L | N | Y | 13.56 | 0.97 | 2.7 | 3.828E5 |  |
 |
4.6552E5 | 3.3725E5 | 3.4561E5 | 1.38 | 1 | 313 | 326 | Oxidation (M) |
| total 16 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.DLTTAGAVTQC(+57.02)YR.D | Y | Y | 6.57 | 2.08 | 0.6 | 3.7528E7 |  |
 |
2.2329E7 | 4.2672E7 | 4.7584E7 | 2.13 | 1 | 99 | 111 | Carbamidomethylation |
| K.C(+57.02)HTPPLYR.M | Y | Y | 4.85 | 3.05 | 1.0 | 2.6403E6 |  |
|
1.5953E6 | 3.2971E6 | 3.8529E6 | 2.42 | 1 | 22 | 29 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.EDITHSAQHALR.L | Y | Y | 4.99 | 5.91 | 2.4 | 5.6564E5 | |
|
2.2524E5 | 7.6794E5 | 9.5202E5 | 4.23 | 1 | 304 | 315 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SESNLSSVC(+57.02)YIFESNNEGEK.I | Y | Y | 14.50 | 4.43 | 0.7 | 1.8191E5 | |
|
2.9488E5 | 1.0083E5 | 1.5002E5 | 2.92 | 1 | 594 | 613 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.GDATVSYEDPPTAK.A | Y | Y | 5.91 | 2.42 | 0.8 | 1.2942E7 |  |
 |
8.7445E6 | 1.6982E7 | 1.7344E7 | 1.98 | 1 | 373 | 386 | |
| K.AAVEWFDGK.D | Y | Y | 5.65 | 2.67 | 0.6 | 7.4316E6 |  |
 |
4.3917E6 | 9.0555E6 | 8.8476E6 | 2.06 | 1 | 387 | 395 | |
| R.TGQPMIHIYLDK.E | Y | Y | 6.07 | 4.32 | 4.3 | 7.1282E6 |  |
 |
4.3172E6 | 7.6871E6 | 9.3804E6 | 2.17 | 2 | 355 | 366 | |
| R.QDHPSSMGVYGQESGGFSGPGENR.S | N | Y | 9.75 | 2.96 | 0.6 | 4.7338E6 |  |
 |
2.7172E6 | 5.8782E6 | 5.6061E6 | 2.16 | 1 | 269 | 292 | |
| R.AGDWQC(+57.02)PNPGC(+57.02)GNQNFAWR.T | N | Y | 7.33 | 4.93 | 1.4 | 3.2132E6 |  |
 |
8.0131E5 | 4.5562E6 | 4.2821E6 | 5.69 | 1 | 481 | 499 | Carbamidomethylation |
| R.GGPGGPGGPGGPMGR.M | N | Y | 3.02 | 0.95 | 6.7 | 1.3407E6 |  |
 |
1.8993E6 | 9.7384E5 | 1.8566E6 | 1.95 | 1 | 434 | 448 | |
| R.QDHPSSM(+15.99)GVYGQESGGFSGPGENR.S | N | Y | 17.01 | 0.98 | 1.9 | 3.0773E5 |  |
 |
3.5517E5 | 3.6656E5 | 2.9312E5 | 1.25 | 1 | 269 | 292 | Oxidation (M) |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.GDATVSYEDPPTAK.A | Y | Y | 5.91 | 2.42 | 0.8 | 1.2942E7 | |
|
8.7445E6 | 1.6982E7 | 1.7344E7 | 1.98 | 1 | 409 | 422 | |
| K.AAVEWFDGK.D | Y | Y | 5.65 | 2.67 | 0.6 | 7.4316E6 | |
|
4.3917E6 | 9.0555E6 | 8.8476E6 | 2.06 | 1 | 423 | 431 | |
| R.TGQPMIHIYLDK.E | Y | Y | 6.07 | 4.32 | 4.3 | 7.1282E6 | |
|
4.3172E6 | 7.6871E6 | 9.3804E6 | 2.17 | 2 | 391 | 402 | |
| R.QDHPSSMGVYGQESGGFSGPGENR.S | N | Y | 9.75 | 2.96 | 0.6 | 4.7338E6 | |
|
2.7172E6 | 5.8782E6 | 5.6061E6 | 2.16 | 1 | 275 | 298 | |
| R.AGDWQC(+57.02)PNPGC(+57.02)GNQNFAWR.T | N | Y | 7.33 | 4.93 | 1.4 | 3.2132E6 | |
|
8.0131E5 | 4.5562E6 | 4.2821E6 | 5.69 | 1 | 517 | 535 | Carbamidomethylation |
| R.GGPGGPGGPGGPMGR.M | N | Y | 3.02 | 0.95 | 6.7 | 1.3407E6 | |
|
1.8993E6 | 9.7384E5 | 1.8566E6 | 1.95 | 1 | 470 | 484 | |
| R.QDHPSSM(+15.99)GVYGQESGGFSGPGENR.S | N | Y | 17.01 | 0.98 | 1.9 | 3.0773E5 | |
|
3.5517E5 | 3.6656E5 | 2.9312E5 | 1.25 | 1 | 275 | 298 | Oxidation (M) |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.GDATVSYEDPPTAK.A | Y | Y | 5.91 | 2.42 | 0.8 | 1.2942E7 | |
|
8.7445E6 | 1.6982E7 | 1.7344E7 | 1.98 | 1 | 410 | 423 | |
| K.AAVEWFDGK.D | Y | Y | 5.65 | 2.67 | 0.6 | 7.4316E6 | |
|
4.3917E6 | 9.0555E6 | 8.8476E6 | 2.06 | 1 | 424 | 432 | |
| R.TGQPMIHIYLDK.E | Y | Y | 6.07 | 4.32 | 4.3 | 7.1282E6 | |
|
4.3172E6 | 7.6871E6 | 9.3804E6 | 2.17 | 2 | 392 | 403 | |
| R.QDHPSSMGVYGQESGGFSGPGENR.S | N | Y | 9.75 | 2.96 | 0.6 | 4.7338E6 | |
|
2.7172E6 | 5.8782E6 | 5.6061E6 | 2.16 | 1 | 269 | 292 | |
| R.AGDWQC(+57.02)PNPGC(+57.02)GNQNFAWR.T | N | Y | 7.33 | 4.93 | 1.4 | 3.2132E6 | |
|
8.0131E5 | 4.5562E6 | 4.2821E6 | 5.69 | 1 | 518 | 536 | Carbamidomethylation |
| R.GGPGGPGGPGGPMGR.M | N | Y | 3.02 | 0.95 | 6.7 | 1.3407E6 | |
|
1.8993E6 | 9.7384E5 | 1.8566E6 | 1.95 | 1 | 471 | 485 | |
| R.QDHPSSM(+15.99)GVYGQESGGFSGPGENR.S | N | Y | 17.01 | 0.98 | 1.9 | 3.0773E5 | |
|
3.5517E5 | 3.6656E5 | 2.9312E5 | 1.25 | 1 | 269 | 292 | Oxidation (M) |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.GDATVSYEDPPTAK.A | Y | Y | 5.91 | 2.42 | 0.8 | 1.2942E7 | |
|
8.7445E6 | 1.6982E7 | 1.7344E7 | 1.98 | 1 | 416 | 429 | |
| K.AAVEWFDGK.D | Y | Y | 5.65 | 2.67 | 0.6 | 7.4316E6 | |
|
4.3917E6 | 9.0555E6 | 8.8476E6 | 2.06 | 1 | 430 | 438 | |
| R.TGQPMIHIYLDK.E | Y | Y | 6.07 | 4.32 | 4.3 | 7.1282E6 | |
|
4.3172E6 | 7.6871E6 | 9.3804E6 | 2.17 | 2 | 398 | 409 | |
| R.QDHPSSMGVYGQESGGFSGPGENR.S | N | Y | 9.75 | 2.96 | 0.6 | 4.7338E6 | |
|
2.7172E6 | 5.8782E6 | 5.6061E6 | 2.16 | 1 | 275 | 298 | |
| R.AGDWQC(+57.02)PNPGC(+57.02)GNQNFAWR.T | N | Y | 7.33 | 4.93 | 1.4 | 3.2132E6 | |
|
8.0131E5 | 4.5562E6 | 4.2821E6 | 5.69 | 1 | 524 | 542 | Carbamidomethylation |
| R.GGPGGPGGPGGPMGR.M | N | Y | 3.02 | 0.95 | 6.7 | 1.3407E6 | |
|
1.8993E6 | 9.7384E5 | 1.8566E6 | 1.95 | 1 | 477 | 491 | |
| R.QDHPSSM(+15.99)GVYGQESGGFSGPGENR.S | N | Y | 17.01 | 0.98 | 1.9 | 3.0773E5 | |
|
3.5517E5 | 3.6656E5 | 2.9312E5 | 1.25 | 1 | 275 | 298 | Oxidation (M) |
| total 7 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SPELQEEFGYNAETQK.L | Y | Y | 6.81 | 4.56 | 3.2 | 5.7462E5 |  |
|
3.7688E5 | 7.9835E5 | 1.1232E6 | 2.98 | 1 | 175 | 190 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.GVSSQETAGIGASAHLVNFK.G | Y | Y | 8.99 | 2.25 | 1.3 | 3.9506E6 |  |
 |
2.9832E6 | 3.09E6 | 5.8007E6 | 1.94 | 2 | 197 | 216 | |
| K.YLLETSGNLDGLEYK.L | Y | Y | 5.62 | 6.90 | 0.7 | 3.0249E6 |  |
 |
1.2384E6 | 2.4931E6 | 5.3433E6 | 4.31 | 1 | 175 | 189 | |
| K.DPVPGYSVPAAEHSTITAWGK.D | Y | Y | 8.69 | 0.95 | 0.4 | 2.1204E6 |  |
 |
1.9051E6 | 1.7803E6 | 2.6759E6 | 1.50 | 1 | 235 | 255 | |
| K.GTDTVAGIALIK.K | N | Y | 22.73 | 3.56 | 1.1 | 1.2573E6 |  |
 |
1.242E6 | 7.4625E5 | 1.7836E6 | 2.39 | 1 | 217 | 228 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IFQNAPTDPTQDFSTQVAK.L | Y | Y | 10.54 | 2.98 | 1.1 | 3.0178E6 |  |
 |
5.0285E6 | 1.8292E6 | 2.1959E6 | 2.75 | 1 | 361 | 379 | |
| R.GTGLQPGEEELPDIAPPLVTPDEPK.G | Y | Y | 7.75 | 4.87 | 0.9 | 3.0749E6 |  |
 |
5.629E6 | 1.7286E6 | 1.867E6 | 3.26 | 2 | 604 | 628 | |
| K.KLDVSIEMPEELDISQLR.G | Y | Y | 6.96 | 3.24 | 0.6 | 1.6522E6 |  |
 |
2.7675E6 | 1.1085E6 | 1.0805E6 | 2.56 | 1 | 586 | 603 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IFQNAPTDPTQDFSTQVAK.L | Y | Y | 10.54 | 2.98 | 1.1 | 3.0178E6 | |
|
5.0285E6 | 1.8292E6 | 2.1959E6 | 2.75 | 1 | 361 | 379 | |
| R.GTGLQPGEEELPDIAPPLVTPDEPK.A | Y | Y | 7.75 | 4.87 | 0.9 | 3.0749E6 | |
|
5.629E6 | 1.7286E6 | 1.867E6 | 3.26 | 2 | 604 | 628 | |
| K.KLDVSIEMPEELDISQLR.G | Y | Y | 6.96 | 3.24 | 0.6 | 1.6522E6 | |
|
2.7675E6 | 1.1085E6 | 1.0805E6 | 2.56 | 1 | 586 | 603 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.RPGEEGTVMSLAGK.Y | Y | Y | 6.79 | 6.81 | 2.5 | 2.5584E6 |  |
 |
1.0194E6 | 4.0127E6 | 3.6464E6 | 3.94 | 1 | 240 | 253 | |
| K.ASDQLQVGVEFEASTR.M | Y | Y | 4.03 | 4.14 | 0.9 | 1.9842E6 |  |
 |
7.5472E5 | 2.9506E6 | 2.4359E6 | 3.91 | 1 | 278 | 293 | |
| K.FVNWQVDGEYR.G | Y | Y | 4.24 | 0.33 | 4.1 | 1.5217E6 |  |
 |
1.7004E6 | 1.7992E6 | 1.4907E6 | 1.21 | 1 | 185 | 195 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.YGVDLIR.Y | Y | Y | 4.85 | 7.08 | 3.2 | 3.8868E6 |  |
 |
1.2816E6 | 3.7979E6 | 6.5809E6 | 5.14 | 1 | 64 | 70 | |
| R.VVALSMSPVDDTFISGSLDK.T | Y | Y | 5.10 | 1.45 | 0.7 | 2.1521E6 |  |
 |
1.6177E6 | 2.5558E6 | 2.2827E6 | 1.58 | 1 | 110 | 129 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.YGVDLIR.Y | Y | Y | 4.85 | 7.08 | 3.2 | 3.8868E6 | |
|
1.2816E6 | 3.7979E6 | 6.5809E6 | 5.14 | 1 | 64 | 70 | |
| R.VVALSMSPVDDTFISGSLDK.T | Y | Y | 5.10 | 1.45 | 0.7 | 2.1521E6 | |
|
1.6177E6 | 2.5558E6 | 2.2827E6 | 1.58 | 1 | 110 | 129 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LPDGSSFTNQFPSDAPLEEAR.Q | Y | Y | 5.75 | 6.60 | 1.1 | 1.609E6 | |
|
2.8528E6 | 9.0369E5 | 1.0706E6 | 3.16 | 1 | 324 | 344 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LPDGSSFTNQFPSDAPLEEAR.Q | Y | Y | 5.75 | 6.60 | 1.1 | 1.609E6 | |
|
2.8528E6 | 9.0369E5 | 1.0706E6 | 3.16 | 1 | 285 | 305 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LPDGSSFTNQFPSDAPLEEAR.Q | Y | Y | 5.75 | 6.60 | 1.1 | 1.609E6 | |
|
2.8528E6 | 9.0369E5 | 1.0706E6 | 3.16 | 1 | 325 | 345 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LPDGSSFTNQFPSDAPLEEAR.Q | Y | Y | 5.75 | 6.60 | 1.1 | 1.609E6 | |
|
2.8528E6 | 9.0369E5 | 1.0706E6 | 3.16 | 1 | 324 | 344 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LQSSQEPEAPPPR.D | Y | Y | 5.21 | 3.83 | 0.8 | 1.4335E6 | |
|
7.6144E5 | 1.5552E6 | 2.3726E6 | 3.12 | 1 | 262 | 274 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SPPGQVTEAVK.V | Y | Y | 4.56 | 4.77 | 0.5 | 2.691E7 |  |
 |
5.0662E7 | 1.306E7 | 2.0272E7 | 3.88 | 1 | 23 | 33 | |
| K.YKPAVNQIEC(+57.02)HPYLTQEK.L | Y | Y | 6.59 | 4.00 | 0.6 | 3.6691E7 |  |
 |
6.5723E7 | 1.8223E7 | 2.6128E7 | 3.61 | 2 | 152 | 169 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SPPGQVTEAVK.V | Y | Y | 4.56 | 4.77 | 0.5 | 2.691E7 | |
|
5.0662E7 | 1.306E7 | 2.0272E7 | 3.88 | 1 | 23 | 33 | |
| K.YKPAVNQIEC(+57.02)HPYLTQEK.L | Y | Y | 6.59 | 4.00 | 0.6 | 3.6691E7 | |
|
6.5723E7 | 1.8223E7 | 2.6128E7 | 3.61 | 2 | 178 | 195 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VPLVAPEDLR.D | Y | Y | 4.52 | 3.43 | 1.0 | 9.4624E6 |  |
 |
4.2441E6 | 1.2135E7 | 1.2009E7 | 2.86 | 1 | 155 | 164 | |
| K.AAILPTSIFLTNK.K | Y | Y | 4.82 | 4.06 | 0.4 | 5.7509E6 |  |
 |
2.621E6 | 8.0314E6 | 6.6002E6 | 3.06 | 1 | 228 | 240 | |
| R.GPLVNASLR.A | Y | Y | 4.54 | 1.54 | 5.3 | 5.1256E6 |  |
 |
3.6339E6 | 5.7606E6 | 5.9822E6 | 1.65 | 1 | 369 | 377 | |
| K.YSQYQQAIYK.C | N | Y | 4.76 | 9.80 | 0.8 | 4.7032E6 |  |
 |
1.2103E6 | 6.5419E6 | 7.9929E6 | 6.60 | 1 | 334 | 343 | |
| K.AAILPTSIFLTNKK.G | N | Y | 5.78 | 4.89 | 0.8 | 1.3028E6 |  |
 |
5.7729E5 | 1.199E6 | 2.1321E6 | 3.69 | 1 | 228 | 241 | |
| K.QGFDFLC(+57.02)MPVFHPR.F | N | Y | 4.87 | 5.41 | 1.9 | 1.0372E6 |  |
 |
4.2031E5 | 1.3214E6 | 1.37E6 | 3.26 | 1 | 36 | 49 | Carbamidomethylation |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AVGPASILK.E | Y | Y | 5.16 | 8.46 | 0.8 | 3.4068E6 |  |
 |
1.2771E6 | 4.0154E6 | 4.928E6 | 3.86 | 1 | 138 | 146 | |
| K.YNLDASEEEDSNK.K | Y | Y | 6.30 | 0.04 | 6.6 | 6.8884E5 |  |
 |
7.4506E5 | 7.5231E5 | 7.5724E5 | 1.02 | 1 | 183 | 195 | |
| K.EVEDKESEGEEEDEDEDLSK.Y | Y | Y | 40.92 | 1.76 | 1.3 | 5.2451E5 |  |
 |
4.3125E5 | 6.4233E5 | 6.6054E5 | 1.53 | 1 | 147 | 166 | |
| K.YKLDEDEDEDDADLSK.Y | N | Y | 18.11 | 16.85 | 1.0 | 2.7048E5 |  |
 |
5.9529E4 | 4.1675E5 | 4.5422E5 | 7.63 | 1 | 167 | 182 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VREEVPLELVEAHVK.K | Y | Y | 7.92 | 3.56 | 0.6 | 2.0682E6 | |
|
8.6071E5 | 2.7415E6 | 2.6024E6 | 3.19 | 1 | 724 | 738 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VREEVPLELVEAHVK.K | Y | Y | 7.92 | 3.56 | 0.6 | 2.0682E6 | |
|
8.6071E5 | 2.7415E6 | 2.6024E6 | 3.19 | 1 | 724 | 738 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VREEVPLELVEAHVK.K | Y | Y | 7.92 | 3.56 | 0.6 | 2.0682E6 | |
|
8.6071E5 | 2.7415E6 | 2.6024E6 | 3.19 | 1 | 724 | 738 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NLIDAGVDALR.V | Y | Y | 5.83 | 3.73 | 0.5 | 1.6148E7 |  |
 |
9.7786E6 | 1.8184E7 | 2.048E7 | 2.09 | 1 | 312 | 322 | |
| R.FGVPVIADGGIQNVGHIAK.A | Y | Y | 4.01 | 3.65 | 6.2 | 1.4171E7 |  |
 |
9.8186E6 | 7.2435E6 | 3.036E7 | 4.19 | 1 | 357 | 375 | |
| K.KYEQGFITDPVVLSPK.D | Y | Y | 7.57 | 2.36 | 1.5 | 1.4123E7 |  |
 |
8.6768E6 | 1.5258E7 | 1.8435E7 | 2.12 | 2 | 109 | 124 | |
| R.VGMGSGSIC(+57.02)ITQEVLAC(+57.02)GRPQATAVYK.V | N | Y | 8.46 | 3.10 | 0.5 | 7.8015E6 |  |
 |
4.9981E6 | 7.2505E6 | 1.1156E7 | 2.23 | 1 | 323 | 349 | Carbamidomethylation |
| R.HGFC(+57.02)GIPITDTGR.M | N | Y | 5.56 | 4.14 | 0.8 | 1.2274E7 |  |
 |
6.3761E6 | 1.2946E7 | 1.7498E7 | 2.74 | 2 | 137 | 149 | Carbamidomethylation |
| K.FVPYLIAGIQHSC(+57.02)QDIGAK.S | N | Y | 3.80 | 1.92 | 0.5 | 5.5295E6 |  |
 |
3.4755E6 | 4.5383E6 | 8.5748E6 | 2.47 | 1 | 456 | 474 | Carbamidomethylation |
| R.AMMYSGELK.F | N | Y | 4.67 | 8.03 | 0.9 | 4.6927E6 |  |
 |
1.5579E6 | 4.8431E6 | 7.6771E6 | 4.93 | 1 | 481 | 489 | |
| K.QLLC(+57.02)GAAIGTHEDDKYR.L | N | Y | 11.63 | 5.13 | 0.6 | 4.2509E6 |  |
 |
2.1304E6 | 5.3376E6 | 6.6192E6 | 3.11 | 1 | 243 | 259 | Carbamidomethylation |
| R.GMGSLDAMDK.H | N | Y | 5.60 | 4.95 | 0.9 | 2.4824E6 |  |
 |
1.2227E6 | 2.6982E6 | 3.5262E6 | 2.88 | 1 | 413 | 422 | |
| R.VGM(+15.99)GSGSIC(+57.02)ITQEVLAC(+57.02)GRPQATAVYK.V | N | Y | 7.22 | 3.49 | 1.2 | 1.2701E6 |  |
 |
7.3749E5 | 1.1204E6 | 1.9523E6 | 2.65 | 1 | 323 | 349 | Oxidation (M); Carbamidomethylation |
| R.RFGVPVIADGGIQNVGHIAK.A | N | Y | 9.99 | 1.59 | 0.4 | 1.131E7 |  |
 |
8.4417E6 | 9.5303E6 | 1.5957E7 | 1.89 | 2 | 356 | 375 | |
| total 11 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AVENYLIQMAR.Y | Y | Y | 4.89 | 2.32 | 0.6 | 1.3685E7 |  |
 |
8.5365E6 | 1.343E7 | 1.909E7 | 2.24 | 1 | 69 | 79 | |
| R.NSILAQVLDQSAR.A | Y | Y | 5.88 | 2.45 | 0.6 | 1.1324E7 |  |
 |
7.864E6 | 9.9857E6 | 1.6123E7 | 2.05 | 1 | 41 | 53 | |
| R.LSNLALVKPEK.T | Y | Y | 4.92 | 1.70 | 0.7 | 5.2987E6 |  |
 |
4.416E6 | 4.8576E6 | 7.8368E6 | 1.77 | 1 | 56 | 66 | |
| K.HGDPGDAAQQEAK.Q | N | Y | 14.60 | 1.88 | 0.8 | 8.2067E3 |  |
 |
6.8418E3 | 8.2883E3 | 1.1562E4 | 1.69 | 1 | 21 | 33 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.FGSLLPIHPVTSG | Y | Y | 4.42 | 0.46 | 4.4 | 7.504E6 |  |
 |
7.7911E6 | 6.6162E6 | 8.1048E6 | 1.22 | 1 | 334 | 346 | |
| R.WIDETPPVDQPSR.F | Y | Y | 3.30 | 4.22 | 2.1 | 6.5541E6 |  |
 |
1.5171E7 | 2.4858E6 | 2.0051E6 | 7.57 | 1 | 87 | 99 | |
| K.TGPFAEHSNQLWNISAVPSWSK.V | Y | Y | 6.11 | 5.22 | 1.8 | 2.826E6 |  |
 |
5.6163E6 | 1.3758E6 | 1.4859E6 | 4.08 | 1 | 288 | 309 | |
| R.IDYGTGHEAAFAAFLC(+57.02)C(+57.02)LC(+57.02)K.I | N | Y | 6.49 | 7.05 | 0.7 | 1.1476E6 |  |
 |
2.5163E6 | 4.5791E5 | 4.6857E5 | 5.50 | 1 | 149 | 168 | Carbamidomethylation |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.EVC(+57.02)SEQAETGPC(+57.02)R.A | Y | Y | 11.76 | 11.45 | 1.7 | 1.8371E5 | |
|
4.4002E5 | 6.8819E4 | 5.9506E4 | 7.39 | 1 | 289 | 301 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.EVC(+57.02)SEQAETGPC(+57.02)R.A | Y | Y | 11.76 | 11.45 | 1.7 | 1.8371E5 | |
|
4.4002E5 | 6.8819E4 | 5.9506E4 | 7.39 | 1 | 289 | 301 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.EVC(+57.02)SEQAETGPC(+57.02)R.A | Y | Y | 11.76 | 11.45 | 1.7 | 1.8371E5 | |
|
4.4002E5 | 6.8819E4 | 5.9506E4 | 7.39 | 1 | 289 | 301 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.AEAYVLAC(+57.02)TDQQYLVPK.D | Y | Y | 16.77 | 5.16 | 1.7 | 4.8355E5 | |
|
2.8802E5 | 4.8165E5 | 6.8098E5 | 2.36 | 1 | 613 | 629 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ALAAGGVGSIVR.V | Y | Y | 3.98 | 2.50 | 0.9 | 9.0459E6 |  |
 |
1.1024E7 | 4.0411E6 | 1.2072E7 | 2.99 | 1 | 132 | 143 | |
| R.KVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSC(+57.02)LR.Q | Y | Y | 5.58 | 3.22 | 2.7 | 1.615E6 |  |
 |
2.9079E6 | 1.1214E6 | 1.096E6 | 2.65 | 1 | 13 | 47 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.EIRPALELLEPIEQK.F | Y | Y | 7.10 | 0.66 | 0.8 | 7.1643E6 |  |
 |
6.4893E6 | 6.6832E6 | 8.3204E6 | 1.28 | 1 | 365 | 379 | |
| K.QLIC(+57.02)DPSYVK.D | Y | Y | 5.39 | 4.28 | 0.9 | 6.7736E6 |  |
 |
3.6033E6 | 7.4178E6 | 9.2997E6 | 2.58 | 1 | 279 | 288 | Carbamidomethylation |
| K.YIAIVSTTVETK.E | Y | Y | 5.18 | 4.17 | 0.8 | 6.5323E6 |  |
 |
2.6619E6 | 8.466E6 | 8.4692E6 | 3.18 | 1 | 349 | 360 | |
| R.VIC(+57.02)ILSHPIK.N | N | Y | 5.46 | 2.84 | 0.5 | 4.0531E6 |  |
 |
2.3089E6 | 4.4917E6 | 5.3588E6 | 2.32 | 1 | 300 | 309 | Carbamidomethylation |
| R.MTGSEFDFEEMKR.K | N | Y | 6.47 | 2.26 | 0.5 | 3.5463E6 |  |
 |
2.4042E6 | 3.3777E6 | 4.8569E6 | 2.02 | 1 | 424 | 436 | |
| R.KSDIYVC(+57.02)MISFAHNVAAQGK.Y | N | Y | 7.53 | 2.93 | 0.9 | 2.1531E6 |  |
 |
3.3983E6 | 1.3639E6 | 1.6972E6 | 2.49 | 1 | 329 | 348 | Carbamidomethylation |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.STLNEIYFGK.T | Y | Y | 5.35 | 2.12 | 0.6 | 9.6885E6 |  |
 |
6.0592E6 | 1.1558E7 | 1.1449E7 | 1.91 | 1 | 226 | 235 | |
| K.SGSGTMNLGGSLTR.Q | Y | Y | 7.09 | 2.21 | 0.4 | 6.8996E6 |  |
 |
4.2727E6 | 8.228E6 | 8.198E6 | 1.93 | 1 | 182 | 195 | |
| R.KLEVEANNAFDQYR.D | Y | Y | 11.61 | 3.02 | 0.6 | 7.2074E6 |  |
 |
3.9666E6 | 8.8601E6 | 8.7956E6 | 2.23 | 2 | 95 | 108 | |
| K.NDLVEALK.R | N | Y | 2.75 | 0.82 | 5.0 | 5.8628E6 |  |
 |
4.3538E6 | 8.9076E6 | 8.654E6 | 2.05 | 1 | 260 | 267 | |
| K.GC(+57.02)WDSIHVVEVQEK.S | N | Y | 6.68 | 1.39 | 1.8 | 6.4939E6 |  |
 |
4.8128E6 | 7.5212E6 | 7.1475E6 | 1.56 | 2 | 146 | 159 | Carbamidomethylation |
| K.YDPPLEDGAMPSAR.L | N | Y | 5.71 | 2.53 | 0.5 | 4.3994E6 |  |
|
2.4297E6 | 5.4897E6 | 5.2787E6 | 2.26 | 1 | 79 | 92 | |
| K.LEVEANNAFDQYR.D | N | Y | 4.66 | 3.38 | 2.5 | 1.0013E6 |  |
 |
1.6881E6 | 6.971E5 | 6.1857E5 | 2.73 | 1 | 96 | 108 | |
| K.LTSTVMLWLQTNK.S | N | Y | 7.95 | 1.97 | 1.2 | 9.342E5 |  |
 |
6.0026E5 | 1.1707E6 | 1.0317E6 | 1.95 | 1 | 169 | 181 | |
| R.QMEKDETVSDC(+57.02)SPHIANIGR.L | N | Y | 21.85 | 2.26 | 0.9 | 6.204E5 |  |
 |
4.8742E5 | 6.4184E5 | 8.9241E5 | 1.83 | 1 | 196 | 215 | Carbamidomethylation |
| total 9 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LPLMEC(+57.02)VQMTQDVQK.A | Y | Y | 4.21 | 2.55 | 2.2 | 3.4111E6 | |
|
1.6878E6 | 4.3184E6 | 4.2272E6 | 2.56 | 1 | 355 | 369 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LPLMEC(+57.02)VQMTQDVQK.A | Y | Y | 4.21 | 2.55 | 2.2 | 3.4111E6 | |
|
1.6878E6 | 4.3184E6 | 4.2272E6 | 2.56 | 1 | 355 | 369 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LPLMEC(+57.02)VQMTQDVQK.A | Y | Y | 4.21 | 2.55 | 2.2 | 3.4111E6 | |
|
1.6878E6 | 4.3184E6 | 4.2272E6 | 2.56 | 1 | 355 | 369 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.AFFPC(+57.02)FDTPAVK.C | Y | Y | 5.71 | 1.59 | 1.0 | 6.6299E6 |  |
 |
7.6607E6 | 4.4748E6 | 7.7542E6 | 1.73 | 1 | 177 | 188 | Carbamidomethylation |
| R.VGEGPGVC(+57.02)WLAPEQTAGK.K | Y | Y | 6.29 | 4.05 | 0.6 | 4.5697E6 |  |
 |
6.8287E6 | 2.3045E6 | 4.5759E6 | 2.96 | 1 | 144 | 161 | Carbamidomethylation |
| K.IEPGVDPDDTYNETPYEK.G | Y | Y | 6.04 | 3.05 | 1.2 | 2.6129E6 |  |
 |
3.7201E6 | 1.6346E6 | 2.4838E6 | 2.28 | 1 | 399 | 416 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.AFFPC(+57.02)FDTPAVK.C | Y | Y | 5.71 | 1.59 | 1.0 | 6.6299E6 | |
|
7.6607E6 | 4.4748E6 | 7.7542E6 | 1.73 | 1 | 177 | 188 | Carbamidomethylation |
| R.VGEGPGVC(+57.02)WLAPEQTAGK.K | Y | Y | 6.29 | 4.05 | 0.6 | 4.5697E6 | |
|
6.8287E6 | 2.3045E6 | 4.5759E6 | 2.96 | 1 | 144 | 161 | Carbamidomethylation |
| K.IEPGVDPDDTYNETPYEK.G | Y | Y | 6.04 | 3.05 | 1.2 | 2.6129E6 | |
|
3.7201E6 | 1.6346E6 | 2.4838E6 | 2.28 | 1 | 399 | 416 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VPLSAYER.V | Y | Y | 4.17 | 2.02 | 2.8 | 5.1762E6 |  |
 |
3.2036E6 | 6.0597E6 | 7.78E6 | 2.43 | 1 | 2318 | 2325 | |
| R.SPVPSAFSDQSR.S | Y | Y | 3.87 | 1.17 | 4.8 | 4.7322E6 |  |
 |
2.9857E6 | 5.2581E6 | 5.9527E6 | 1.99 | 1 | 2384 | 2395 | |
| R.MAPALSGANLTSPR.V | Y | Y | 6.39 | 2.59 | 0.7 | 2.1577E6 |  |
 |
1.3501E6 | 2.0319E6 | 3.091E6 | 2.29 | 1 | 2304 | 2317 | |
| R.TPAAAAAMNLASPR.T | N | Y | 7.05 | 2.59 | 0.4 | 1.98E6 |  |
 |
1.1308E6 | 1.9928E6 | 2.8163E6 | 2.49 | 1 | 2194 | 2207 | |
| R.AAFGISDSYVDGSSFDPQR.R | N | Y | 16.02 | 1.59 | 1.1 | 1.889E6 |  |
 |
2.0247E6 | 3.2635E6 | 2.3893E6 | 1.61 | 1 | 137 | 155 | |
| R.IPAASAAAMNLASAR.T | N | Y | 7.52 | 1.52 | 2.4 | 1.8334E6 |  |
 |
1.2753E6 | 1.9211E6 | 2.3038E6 | 1.81 | 1 | 2165 | 2179 | |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IISNVPADSLIR.T | Y | Y | 5.87 | 4.03 | 3.7 | 2.4928E6 |  |
 |
4.5457E6 | 1.3856E6 | 1.5469E6 | 3.28 | 1 | 200 | 211 | |
| K.YAVGEEC(+57.02)DFEVGK.E | Y | Y | 7.99 | 0.41 | 0.5 | 6.413E5 |  |
 |
6.5023E5 | 6.7477E5 | 7.6146E5 | 1.17 | 1 | 83 | 95 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IISNVPADSLIR.T | Y | Y | 5.87 | 4.03 | 3.7 | 2.4928E6 | |
|
4.5457E6 | 1.3856E6 | 1.5469E6 | 3.28 | 1 | 231 | 242 | |
| K.YAVGEEC(+57.02)DFEVGK.E | Y | Y | 7.99 | 0.41 | 0.5 | 6.413E5 | |
|
6.5023E5 | 6.7477E5 | 7.6146E5 | 1.17 | 1 | 114 | 126 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ALLANALTSALR.L | Y | Y | 4.93 | 4.04 | 2.3 | 6.0629E6 | |
|
2.8808E6 | 6.4059E6 | 8.9021E6 | 3.09 | 1 | 58 | 69 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ALLANALTSALR.L | Y | Y | 4.93 | 4.04 | 2.3 | 6.0629E6 | |
|
2.8808E6 | 6.4059E6 | 8.9021E6 | 3.09 | 1 | 58 | 69 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.HLEPEPEEEIIAEDYDDDPVDYEATR.I | Y | Y | 6.76 | 2.55 | 1.0 | 2.2653E6 |  |
 |
1.2992E6 | 2.699E6 | 2.7978E6 | 2.15 | 1 | 19 | 44 | |
| R.KDEELDPMDPSSYSDAPR.G | Y | Y | 9.76 | 3.69 | 0.8 | 9.4744E5 |  |
|
4.572E5 | 1.1733E6 | 1.2118E6 | 2.65 | 1 | 195 | 212 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SWQDELAQQAEEGSAR.L | Y | Y | 5.46 | 2.77 | 0.9 | 2.1517E6 |  |
 |
1.2081E6 | 2.5821E6 | 2.665E6 | 2.21 | 1 | 132 | 147 | |
| R.TELGLDLGLEPK.R | Y | Y | 5.71 | 3.11 | 0.5 | 1.9024E6 |  |
 |
9.4764E5 | 2.2749E6 | 2.4846E6 | 2.62 | 1 | 161 | 172 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.WGTPVPLEGFEDK.V | Y | Y | 5.55 | 2.07 | 0.3 | 4.3224E6 |  |
 |
2.9168E6 | 4.8704E6 | 5.18E6 | 1.78 | 1 | 503 | 515 | |
| K.NPEQVDLYQFMAK.D | Y | Y | 4.97 | 4.17 | 0.7 | 2.6776E6 |  |
 |
1.375E6 | 2.7825E6 | 4.2189E6 | 3.07 | 1 | 544 | 556 | |
| R.SILTISR.H | Y | Y | 5.14 | 1.69 | 3.3 | 2.6207E6 |  |
 |
1.7566E6 | 2.8621E6 | 3.2433E6 | 1.85 | 1 | 709 | 715 | |
| R.HGNQYIQVNEPWK.R | N | Y | 5.36 | 0.47 | 0.7 | 1.8749E6 |  |
 |
1.8866E6 | 1.7078E6 | 2.0302E6 | 1.19 | 1 | 716 | 728 | |
| R.FVEGVC(+57.02)PFC(+57.02)GYEEAR.G | N | Y | 5.75 | 11.13 | 4.5 | 1.4088E6 |  |
 |
4.1965E5 | 1.3472E6 | 2.4594E6 | 5.86 | 1 | 402 | 416 | Carbamidomethylation |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.QLAQIDGTLSTIEFQR.E | Y | Y | 5.63 | 3.20 | 1.2 | 2.4226E6 | |
|
1.3409E6 | 2.7057E6 | 3.221E6 | 2.40 | 1 | 78 | 93 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.QLAQIDGTLSTIEFQR.E | Y | Y | 5.63 | 3.20 | 1.2 | 2.4226E6 | |
|
1.3409E6 | 2.7057E6 | 3.221E6 | 2.40 | 1 | 78 | 93 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.FVINYDYPNSSEDYIHR.I | Y | Y | 10.95 | 1.54 | 1.0 | 2.5305E7 |  |
 |
1.7701E7 | 3.1595E7 | 2.662E7 | 1.78 | 2 | 412 | 428 | |
| R.TTYLVLDEADR.M | Y | Y | 5.18 | 0.98 | 1.2 | 1.8998E7 |  |
 |
1.4811E7 | 2.2114E7 | 2.007E7 | 1.49 | 1 | 242 | 252 | |
| R.LIDFLEC(+57.02)GK.T | N | Y | 5.28 | 3.36 | 0.5 | 1.7973E7 |  |
 |
1.0617E7 | 2.146E7 | 2.1841E7 | 2.06 | 1 | 228 | 236 | Carbamidomethylation |
| K.NFYQEHPDLAR.R | N | Y | 5.52 | 1.88 | 2.0 | 1.8975E7 |  |
 |
1.312E7 | 2.5232E7 | 2.488E7 | 1.92 | 2 | 57 | 67 | |
| K.LLQLVEDR.G | N | Y | 4.73 | 4.94 | 0.6 | 1.5986E7 |  |
 |
4.5427E6 | 2.1447E7 | 2.1968E7 | 4.84 | 1 | 471 | 478 | |
| K.WNLDELPK.F | N | Y | 5.85 | 1.98 | 0.3 | 1.1914E7 |  |
 |
7.7521E6 | 1.4257E7 | 1.3733E7 | 1.84 | 1 | 46 | 53 | |
| K.TIVFVETK.R | N | Y | 5.16 | 2.98 | 0.6 | 1.1218E7 |  |
 |
7.3227E6 | 1.3752E7 | 1.2579E7 | 1.88 | 1 | 344 | 351 | |
| R.QLAEDFLK.D | N | Y | 4.74 | 3.30 | 0.5 | 1.0137E7 |  |
 |
4.9572E6 | 1.1785E7 | 1.3669E7 | 2.76 | 1 | 288 | 295 | |
| R.LMEEIMSEK.E | N | Y | 4.52 | 3.07 | 0.7 | 9.1985E6 |  |
 |
4.392E6 | 1.125E7 | 1.1953E7 | 2.72 | 1 | 332 | 340 | |
| K.QVSDLISVLR.E | N | Y | 4.55 | 1.69 | 0.7 | 8.9023E6 |  |
 |
6.1129E6 | 1.0346E7 | 1.0248E7 | 1.69 | 1 | 452 | 461 | |
| K.TGTAYTFFTPNNIK.Q | N | Y | 6.04 | 3.76 | 1.9 | 6.0145E6 |  |
 |
8.4966E6 | 3.417E6 | 6.1298E6 | 2.49 | 1 | 438 | 451 | |
| R.DWVLNEFK.H | N | Y | 3.95 | 10.38 | 6.4 | 5.8246E6 |  |
 |
4.8537E5 | 8.9406E6 | 8.0477E6 | 18.42 | 1 | 381 | 388 | |
| K.TLSYLLPAIVHINHQPFLER.G | N | Y | 4.66 | 1.08 | 0.7 | 1.3941E7 |  |
 |
1.1949E7 | 1.7526E7 | 1.2349E7 | 1.47 | 2 | 145 | 164 | |
| R.ELAQQVQQVAAEYC(+57.02)R.A | Y | Y | 7.05 | 3.54 | 0.5 | 2.3772E7 |  |
 |
9.2217E6 | 3.1009E7 | 3.1086E7 | 3.37 | 2 | 178 | 192 | Carbamidomethylation |
| total 14 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.FVINYDYPNSSEDYIHR.I | Y | Y | 10.95 | 1.54 | 1.0 | 2.5305E7 | |
|
1.7701E7 | 3.1595E7 | 2.662E7 | 1.78 | 2 | 414 | 430 | |
| R.TTYLVLDEADR.M | Y | Y | 5.18 | 0.98 | 1.2 | 1.8998E7 | |
|
1.4811E7 | 2.2114E7 | 2.007E7 | 1.49 | 1 | 244 | 254 | |
| R.LIDFLEC(+57.02)GK.T | N | Y | 5.28 | 3.36 | 0.5 | 1.7973E7 | |
|
1.0617E7 | 2.146E7 | 2.1841E7 | 2.06 | 1 | 230 | 238 | Carbamidomethylation |
| K.NFYQEHPDLAR.R | N | Y | 5.52 | 1.88 | 2.0 | 1.8975E7 | |
|
1.312E7 | 2.5232E7 | 2.488E7 | 1.92 | 2 | 59 | 69 | |
| K.LLQLVEDR.G | N | Y | 4.73 | 4.94 | 0.6 | 1.5986E7 | |
|
4.5427E6 | 2.1447E7 | 2.1968E7 | 4.84 | 1 | 473 | 480 | |
| K.WNLDELPK.F | N | Y | 5.85 | 1.98 | 0.3 | 1.1914E7 | |
|
7.7521E6 | 1.4257E7 | 1.3733E7 | 1.84 | 1 | 48 | 55 | |
| K.TIVFVETK.R | N | Y | 5.16 | 2.98 | 0.6 | 1.1218E7 | |
|
7.3227E6 | 1.3752E7 | 1.2579E7 | 1.88 | 1 | 346 | 353 | |
| R.QLAEDFLK.D | N | Y | 4.74 | 3.30 | 0.5 | 1.0137E7 | |
|
4.9572E6 | 1.1785E7 | 1.3669E7 | 2.76 | 1 | 290 | 297 | |
| R.LMEEIMSEK.E | N | Y | 4.52 | 3.07 | 0.7 | 9.1985E6 | |
|
4.392E6 | 1.125E7 | 1.1953E7 | 2.72 | 1 | 334 | 342 | |
| K.QVSDLISVLR.E | N | Y | 4.55 | 1.69 | 0.7 | 8.9023E6 | |
|
6.1129E6 | 1.0346E7 | 1.0248E7 | 1.69 | 1 | 454 | 463 | |
| K.TGTAYTFFTPNNIK.Q | N | Y | 6.04 | 3.76 | 1.9 | 6.0145E6 | |
|
8.4966E6 | 3.417E6 | 6.1298E6 | 2.49 | 1 | 440 | 453 | |
| R.DWVLNEFK.H | N | Y | 3.95 | 10.38 | 6.4 | 5.8246E6 | |
|
4.8537E5 | 8.9406E6 | 8.0477E6 | 18.42 | 1 | 383 | 390 | |
| K.TLSYLLPAIVHINHQPFLER.G | N | Y | 4.66 | 1.08 | 0.7 | 1.3941E7 | |
|
1.1949E7 | 1.7526E7 | 1.2349E7 | 1.47 | 2 | 147 | 166 | |
| R.ELAQQVQQVAAEYC(+57.02)R.A | Y | Y | 7.05 | 3.54 | 0.5 | 2.3772E7 | |
|
9.2217E6 | 3.1009E7 | 3.1086E7 | 3.37 | 2 | 180 | 194 | Carbamidomethylation |
| total 14 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VIGSELVQK.Y | Y | Y | 4.86 | 5.44 | 3.6 | 1.2262E7 |  |
 |
1.8807E7 | 6.285E6 | 1.1695E7 | 2.99 | 1 | 240 | 248 | |
| K.GVLLFGPPGTGK.T | Y | Y | 4.74 | 2.37 | 0.5 | 1.141E7 |  |
 |
1.7147E7 | 7.8908E6 | 9.1925E6 | 2.17 | 1 | 211 | 222 | |
| R.ALDEGDIALLK.T | Y | Y | 4.71 | 0.74 | 0.6 | 8.2604E6 |  |
 |
9.7574E6 | 7.4018E6 | 7.622E6 | 1.32 | 1 | 24 | 34 | |
| K.QTLQSEQPLQVAR.C | N | Y | 6.55 | 3.57 | 0.6 | 6.3433E6 |  |
 |
1.0577E7 | 3.8189E6 | 4.6338E6 | 2.77 | 1 | 85 | 97 | |
| K.ESDTGLAPPALWDLAADK.Q | N | Y | 3.83 | 0.83 | 3.6 | 5.1478E6 |  |
 |
6.0354E6 | 3.5449E6 | 5.8632E6 | 1.70 | 1 | 67 | 84 | |
| R.FVNLGIEPPK.G | N | Y | 3.95 | 1.01 | 6.3 | 5.006E6 |  |
 |
3.8523E6 | 5.0601E6 | 6.1058E6 | 1.58 | 1 | 201 | 210 | |
| K.YQIHIPLPPK.I | N | Y | 5.17 | 2.67 | 0.8 | 4.6975E6 |  |
 |
6.9599E6 | 2.8769E6 | 4.2556E6 | 2.42 | 1 | 147 | 156 | |
| K.IINADSEDPK.Y | N | Y | 5.08 | 1.70 | 0.8 | 4.5638E6 |  |
 |
6.4967E6 | 3.3873E6 | 4.6543E6 | 1.92 | 1 | 101 | 110 | |
| K.IDPTVTMMQVEEKPDVTYSDVGGC(+57.02)K.E | N | Y | 8.74 | 2.37 | 0.7 | 3.6969E6 |  |
 |
5.2521E6 | 2.5032E6 | 3.3354E6 | 2.10 | 1 | 157 | 181 | Carbamidomethylation |
| K.FVVDLSDQVAPTDIEEGMR.V | N | Y | 5.40 | 1.66 | 0.6 | 3.635E6 |  |
 |
4.8403E6 | 3.1003E6 | 2.9643E6 | 1.63 | 1 | 121 | 139 | |
| R.SVC(+57.02)TEAGMFAIR.A | N | Y | 5.15 | 2.87 | 1.7 | 2.9772E6 |  |
 |
4.1103E6 | 2.0469E6 | 2.7743E6 | 2.01 | 1 | 387 | 398 | Carbamidomethylation |
| R.FDDGAGGDNEVQR.T | N | Y | 4.70 | 2.39 | 1.5 | 2.8989E6 |  |
 |
4.0749E6 | 1.5757E6 | 3.0459E6 | 2.59 | 1 | 285 | 297 | |
| K.FVVDLSDQVAPTDIEEGM(+15.99)R.V | N | Y | 5.82 | 16.33 | 1.6 | 1.6486E6 |  |
 |
3.6612E6 | 7.3419E5 | 5.5039E5 | 6.65 | 1 | 121 | 139 | Oxidation (M) |
| R.KIEFSLPDLEGR.T | N | Y | 6.78 | 3.51 | 0.6 | 1.0478E6 |  |
 |
1.4747E6 | 5.7379E5 | 1.095E6 | 2.57 | 1 | 340 | 351 | |
| K.IATEKDFLEAVNK.V | N | Y | 7.75 | 6.11 | 0.8 | 8.6135E5 |  |
 |
1.4103E6 | 3.4851E5 | 8.2521E5 | 4.05 | 1 | 403 | 415 | |
| total 15 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VLTPEEQLADK.L | Y | Y | 5.23 | 3.72 | 4.3 | 6.022E6 |  |
|
1.0082E7 | 4.3046E6 | 3.6798E6 | 2.74 | 1 | 108 | 118 | |
| K.ITNSLTVLC(+57.02)SEK.Q | Y | Y | 6.32 | 2.19 | 0.6 | 4.9755E6 |  |
 |
7.0484E6 | 3.5137E6 | 4.3645E6 | 2.01 | 1 | 200 | 211 | Carbamidomethylation |
| K.KLQEESDLELAK.E | Y | Y | 6.28 | 1.81 | 6.5 | 4.7938E5 |  |
 |
6.8146E5 | 4.3636E5 | 4.294E5 | 1.59 | 1 | 123 | 134 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VLTPEEQLADK.L | Y | Y | 5.23 | 3.72 | 4.3 | 6.022E6 | |
|
1.0082E7 | 4.3046E6 | 3.6798E6 | 2.74 | 1 | 97 | 107 | |
| K.ITNSLTVLC(+57.02)SEK.Q | Y | Y | 6.32 | 2.19 | 0.6 | 4.9755E6 | |
|
7.0484E6 | 3.5137E6 | 4.3645E6 | 2.01 | 1 | 189 | 200 | Carbamidomethylation |
| K.KLQEESDLELAK.E | Y | Y | 6.28 | 1.81 | 6.5 | 4.7938E5 | |
|
6.8146E5 | 4.3636E5 | 4.294E5 | 1.59 | 1 | 112 | 123 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AAHIFFTDTC(+57.02)PEPLFSELGR.S | Y | Y | 7.76 | 5.74 | 3.9 | 1.1195E6 | |
|
2.2631E6 | 5.286E5 | 5.669E5 | 4.28 | 1 | 101 | 120 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AAHIFFTDTC(+57.02)PEPLFSELGR.S | Y | Y | 7.76 | 5.74 | 3.9 | 1.1195E6 | |
|
2.2631E6 | 5.286E5 | 5.669E5 | 4.28 | 1 | 101 | 120 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AAHIFFTDTC(+57.02)PEPLFSELGR.S | Y | Y | 7.76 | 5.74 | 3.9 | 1.1195E6 | |
|
2.2631E6 | 5.286E5 | 5.669E5 | 4.28 | 1 | 101 | 120 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.FYGPEGPYGVFAGR.D | Y | Y | 5.37 | 3.29 | 0.4 | 1.0414E7 | |
|
6.9511E6 | 9.5199E6 | 1.477E7 | 2.12 | 1 | 106 | 119 | |
| R.KFYGPEGPYGVFAGR.D | N | Y | 6.01 | 2.85 | 0.6 | 3.0668E6 |  |
 |
2.1202E6 | 2.0914E6 | 4.9887E6 | 2.39 | 1 | 105 | 119 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NIDEHANEDVER.M | Y | Y | 7.74 | 1.50 | 0.6 | 3.7374E6 |  |
 |
4.5803E6 | 2.8177E6 | 3.8892E6 | 1.63 | 2 | 106 | 117 | |
| R.KTPVKEPNSENVDISSGGGVTGWK.S | Y | Y | 12.00 | 4.34 | 0.7 | 2.267E6 |  |
 |
3.8262E6 | 1.2446E6 | 1.7302E6 | 3.07 | 1 | 173 | 196 | |
| K.EPNSENVDISSGGGVTGWK.S | N | Y | 10.39 | 2.21 | 0.8 | 1.2258E6 |  |
 |
1.7278E6 | 1.1317E6 | 8.1795E5 | 2.11 | 1 | 178 | 196 | |
| K.TPVKEPNSENVDISSGGGVTGWK.S | N | Y | 23.60 | 4.38 | 1.0 | 5.984E5 |  |
 |
1.0344E6 | 3.8963E5 | 3.7112E5 | 2.79 | 1 | 174 | 196 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AGADIELGC(+57.02)STPLMEAAQEGHLELVK.Y | Y | Y | 6.65 | 4.83 | 2.1 | 8.2235E5 |  |
 |
3.1438E5 | 1.0997E6 | 1.1315E6 | 3.60 | 1 | 541 | 566 | Carbamidomethylation |
| R.SLAEAC(+57.02)SEGDVNAVR.K | Y | Y | 11.38 | 2.35 | 3.1 | 5.08E5 |  |
 |
3.8065E5 | 5.3398E5 | 7.4286E5 | 1.95 | 1 | 222 | 236 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AGADIELGC(+57.02)STPLMEAAQEGHLELVK.Y | Y | Y | 6.65 | 4.83 | 2.1 | 8.2235E5 | |
|
3.1438E5 | 1.0997E6 | 1.1315E6 | 3.60 | 1 | 541 | 566 | Carbamidomethylation |
| R.SLAEAC(+57.02)SEGDVNAVR.K | Y | Y | 11.38 | 2.35 | 3.1 | 5.08E5 | |
|
3.8065E5 | 5.3398E5 | 7.4286E5 | 1.95 | 1 | 222 | 236 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AGADIELGC(+57.02)STPLMEAAQEGHLELVK.Y | Y | Y | 6.65 | 4.83 | 2.1 | 8.2235E5 | |
|
3.1438E5 | 1.0997E6 | 1.1315E6 | 3.60 | 1 | 443 | 468 | Carbamidomethylation |
| R.SLAEAC(+57.02)SEGDVNAVR.K | Y | Y | 11.38 | 2.35 | 3.1 | 5.08E5 | |
|
3.8065E5 | 5.3398E5 | 7.4286E5 | 1.95 | 1 | 124 | 138 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.TGAPQYGSYGTAPVNLNIK.A | Y | Y | 7.93 | 3.32 | 1.4 | 1.2438E6 | |
|
5.377E5 | 1.6138E6 | 1.58E6 | 3.00 | 1 | 104 | 122 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.DNPGVVTC(+57.02)LDEAR.H | Y | Y | 5.94 | 5.36 | 0.5 | 2.1528E7 |  |
 |
7.7289E6 | 2.5232E7 | 3.1622E7 | 4.09 | 1 | 227 | 239 | Carbamidomethylation |
| R.AENYDISPADR.H | Y | Y | 6.08 | 2.90 | 0.7 | 2.0885E7 |  |
 |
1.6593E7 | 2.1951E7 | 2.9597E7 | 1.78 | 1 | 870 | 880 | |
| K.IHVSDQELQSANASVDDSRLEELK.A | N | Y | 8.28 | 1.56 | 0.6 | 1.8919E7 |  |
 |
1.4837E7 | 1.6122E7 | 2.5797E7 | 1.74 | 2 | 807 | 830 | |
| R.QLLHNFPPDQLTSSGAPFWSGPK.R | N | Y | 4.97 | 1.57 | 1.1 | 1.2184E7 |  |
 |
9.6194E6 | 1.5229E7 | 1.1702E7 | 1.58 | 1 | 724 | 746 | |
| K.ATLPSPDKLPGFK.M | N | Y | 6.06 | 2.57 | 1.2 | 1.4452E7 |  |
 |
1.0328E7 | 1.3952E7 | 1.9075E7 | 1.85 | 2 | 831 | 843 | |
| R.ALVLELC(+57.02)C(+57.02)NDESGEDVEVPYVR.Y | N | Y | 4.77 | 0.37 | 0.6 | 2.0115E7 |  |
 |
1.8748E7 | 2.1064E7 | 2.0532E7 | 1.12 | 2 | 1033 | 1054 | Carbamidomethylation |
| K.ATLPSPDK.L | N | Y | 4.62 | 0.82 | 0.6 | 4.5744E6 |  |
 |
4.3821E6 | 5.9093E6 | 4.9091E6 | 1.35 | 1 | 831 | 838 | |
| R.LAGTQPLEVLEAVQR.S | Y | Y | 5.57 | 1.78 | 0.6 | 4.2213E7 |  |
 |
3.1435E7 | 4.4537E7 | 5.0665E7 | 1.61 | 2 | 679 | 693 | |
| K.IHVSDQELQSANASVDDSR.L | N | Y | 13.73 | 4.35 | 0.9 | 1.1111E6 |  |
 |
5.4567E5 | 1.537E6 | 1.2505E6 | 2.82 | 1 | 807 | 825 | |
| K.GNVQVVIPFLTESYSSSQDPPEK.S | N | Y | 3.50 | 2.20 | 3.6 | 6.366E5 |  |
 |
1.1921E6 | 1.0779E6 | 4.1454E5 | 2.88 | 1 | 605 | 627 | |
| total 10 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AGDTVIPLYIPQC(+57.02)GEC(+57.02)K.F | Y | Y | 5.73 | 3.20 | 0.6 | 5.2585E6 |  |
 |
2.9481E6 | 5.8661E6 | 6.9611E6 | 2.36 | 1 | 579 | 595 | Carbamidomethylation |
| K.VC(+57.02)LLGC(+57.02)GISTGYGAAVNTAK.V | Y | Y | 6.57 | 2.92 | 0.7 | 4.861E6 |  |
 |
2.5708E6 | 5.3427E6 | 6.6694E6 | 2.59 | 1 | 663 | 682 | Carbamidomethylation |
| K.EFGATEC(+57.02)INPQDFSK.S | Y | Y | 7.53 | 0.76 | 0.7 | 2.3151E6 |  |
 |
2.1549E6 | 2.7467E6 | 2.0436E6 | 1.34 | 1 | 728 | 742 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VPTTEKPTVTVNFR.K | Y | Y | 13.44 | 3.32 | 1.4 | 1.2042E7 |  |
|
8.592E6 | 7.6086E6 | 1.9925E7 | 2.62 | 2 | 829 | 842 | |
| K.ITKPGSIDSNNQLFAPGGR.L | Y | Y | 8.15 | 0.99 | 0.5 | 6.903E6 |  |
 |
6.1905E6 | 5.8684E6 | 8.6502E6 | 1.47 | 1 | 1074 | 1092 | |
| K.VEYTLGEESEAPGQR.A | Y | Y | 5.90 | 3.24 | 0.9 | 5.3331E6 |  |
 |
2.9408E6 | 6.021E6 | 7.0375E6 | 2.39 | 1 | 1420 | 1434 | |
| K.EAVGDLLDAFK.E | N | Y | 4.07 | 3.88 | 3.9 | 3.7449E6 |  |
 |
1.1206E6 | 4.8139E6 | 5.5804E6 | 4.98 | 1 | 527 | 537 | |
| K.SDQWKPLNLEEK.K | N | Y | 7.20 | 1.87 | 0.8 | 3.4945E6 |  |
 |
2.4698E6 | 3.4374E6 | 4.5763E6 | 1.85 | 1 | 600 | 611 | |
| R.LKEELEEAR.D | N | Y | 4.85 | 1.08 | 0.8 | 1.5716E6 |  |
 |
1.4743E6 | 1.4928E6 | 2.1207E6 | 1.44 | 1 | 882 | 890 | |
| K.AIIEEYLHLNDMK.E | N | Y | 7.85 | 1.95 | 0.9 | 1.4094E6 |  |
 |
1.0487E6 | 1.3065E6 | 1.873E6 | 1.79 | 1 | 1246 | 1258 | |
| K.GVIDLIFEK.A | N | Y | 5.31 | 2.33 | 0.8 | 1.0861E6 |  |
 |
6.9597E5 | 1.4237E6 | 1.1387E6 | 2.05 | 1 | 798 | 806 | |
| R.FMLQDVLDLR.Q | N | Y | 9.03 | 24.58 | 0.6 | 4.7988E5 |  |
 |
7.158E5 | 1.7864E6 | 3.8352E4 | 46.58 | 1 | 979 | 988 | |
| K.QKEMDEAATAEER.G | N | Y | 25.12 | 3.29 | 1.8 | 1.0961E5 |  |
 |
7.7145E4 | 1.017E5 | 1.7542E5 | 2.27 | 1 | 867 | 879 | |
| total 10 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VPTTEKPTVTVNFR.K | Y | Y | 13.44 | 3.32 | 1.4 | 1.2042E7 | |
|
8.592E6 | 7.6086E6 | 1.9925E7 | 2.62 | 2 | 865 | 878 | |
| K.ITKPGSIDSNNQLFAPGGR.L | Y | Y | 8.15 | 0.99 | 0.5 | 6.903E6 | |
|
6.1905E6 | 5.8684E6 | 8.6502E6 | 1.47 | 1 | 1110 | 1128 | |
| K.VEYTLGEESEAPGQR.A | Y | Y | 5.90 | 3.24 | 0.9 | 5.3331E6 | |
|
2.9408E6 | 6.021E6 | 7.0375E6 | 2.39 | 1 | 1456 | 1470 | |
| K.EAVGDLLDAFK.E | N | Y | 4.07 | 3.88 | 3.9 | 3.7449E6 | |
|
1.1206E6 | 4.8139E6 | 5.5804E6 | 4.98 | 1 | 563 | 573 | |
| K.SDQWKPLNLEEK.K | N | Y | 7.20 | 1.87 | 0.8 | 3.4945E6 | |
|
2.4698E6 | 3.4374E6 | 4.5763E6 | 1.85 | 1 | 636 | 647 | |
| R.LKEELEEAR.D | N | Y | 4.85 | 1.08 | 0.8 | 1.5716E6 | |
|
1.4743E6 | 1.4928E6 | 2.1207E6 | 1.44 | 1 | 918 | 926 | |
| K.AIIEEYLHLNDMK.E | N | Y | 7.85 | 1.95 | 0.9 | 1.4094E6 | |
|
1.0487E6 | 1.3065E6 | 1.873E6 | 1.79 | 1 | 1282 | 1294 | |
| K.GVIDLIFEK.A | N | Y | 5.31 | 2.33 | 0.8 | 1.0861E6 | |
|
6.9597E5 | 1.4237E6 | 1.1387E6 | 2.05 | 1 | 834 | 842 | |
| R.FMLQDVLDLR.Q | N | Y | 9.03 | 24.58 | 0.6 | 4.7988E5 | |
|
7.158E5 | 1.7864E6 | 3.8352E4 | 46.58 | 1 | 1015 | 1024 | |
| K.QKEMDEAATAEER.G | N | Y | 25.12 | 3.29 | 1.8 | 1.0961E5 | |
|
7.7145E4 | 1.017E5 | 1.7542E5 | 2.27 | 1 | 903 | 915 | |
| total 10 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VPTTEKPTVTVNFR.K | Y | Y | 13.44 | 3.32 | 1.4 | 1.2042E7 | |
|
8.592E6 | 7.6086E6 | 1.9925E7 | 2.62 | 2 | 872 | 885 | |
| K.ITKPGSIDSNNQLFAPGGR.L | Y | Y | 8.15 | 0.99 | 0.5 | 6.903E6 | |
|
6.1905E6 | 5.8684E6 | 8.6502E6 | 1.47 | 1 | 1117 | 1135 | |
| K.VEYTLGEESEAPGQR.A | Y | Y | 5.90 | 3.24 | 0.9 | 5.3331E6 | |
|
2.9408E6 | 6.021E6 | 7.0375E6 | 2.39 | 1 | 1463 | 1477 | |
| K.EAVGDLLDAFK.E | N | Y | 4.07 | 3.88 | 3.9 | 3.7449E6 | |
|
1.1206E6 | 4.8139E6 | 5.5804E6 | 4.98 | 1 | 570 | 580 | |
| K.SDQWKPLNLEEK.K | N | Y | 7.20 | 1.87 | 0.8 | 3.4945E6 | |
|
2.4698E6 | 3.4374E6 | 4.5763E6 | 1.85 | 1 | 643 | 654 | |
| R.LKEELEEAR.D | N | Y | 4.85 | 1.08 | 0.8 | 1.5716E6 | |
|
1.4743E6 | 1.4928E6 | 2.1207E6 | 1.44 | 1 | 925 | 933 | |
| K.AIIEEYLHLNDMK.E | N | Y | 7.85 | 1.95 | 0.9 | 1.4094E6 | |
|
1.0487E6 | 1.3065E6 | 1.873E6 | 1.79 | 1 | 1289 | 1301 | |
| K.GVIDLIFEK.A | N | Y | 5.31 | 2.33 | 0.8 | 1.0861E6 | |
|
6.9597E5 | 1.4237E6 | 1.1387E6 | 2.05 | 1 | 841 | 849 | |
| R.FMLQDVLDLR.Q | N | Y | 9.03 | 24.58 | 0.6 | 4.7988E5 | |
|
7.158E5 | 1.7864E6 | 3.8352E4 | 46.58 | 1 | 1022 | 1031 | |
| K.QKEMDEAATAEER.G | N | Y | 25.12 | 3.29 | 1.8 | 1.0961E5 | |
|
7.7145E4 | 1.017E5 | 1.7542E5 | 2.27 | 1 | 910 | 922 | |
| total 10 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.AVDNQVYVATASPAR.D | Y | Y | 8.21 | 2.61 | 1.1 | 2.1458E6 |  |
 |
3.3149E6 | 1.3687E6 | 1.7537E6 | 2.42 | 1 | 236 | 250 | |
| K.TLSPGDSFSTFDTPYC(+57.02)R.V | Y | Y | 6.75 | 1.78 | 0.6 | 1.4792E6 |  |
 |
1.9395E6 | 1.0749E6 | 1.4232E6 | 1.80 | 1 | 171 | 187 | Carbamidomethylation |
| K.IHLFDIDVPGK.I | Y | Y | 8.27 | 1.65 | 0.9 | 9.9245E4 |  |
 |
1.0938E5 | 7.8081E4 | 1.3762E5 | 1.76 | 1 | 153 | 163 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ALGLFSNDIPHVVR.Y | Y | Y | 5.56 | 13.62 | 0.7 | 1.1883E6 | |
|
2.5866E5 | 1.6699E6 | 1.6364E6 | 6.46 | 1 | 22 | 35 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ALGLFSNDIPHVVR.Y | Y | Y | 5.56 | 13.62 | 0.7 | 1.1883E6 | |
|
2.5866E5 | 1.6699E6 | 1.6364E6 | 6.46 | 1 | 19 | 32 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.GELLLQLC(+57.02)R.L | Y | Y | 4.53 | 4.96 | 0.7 | 4.3116E6 |  |
 |
1.6405E6 | 4.9909E6 | 6.3033E6 | 3.84 | 1 | 231 | 239 | Carbamidomethylation |
| R.WMDEAQALDTADR.F | Y | Y | 6.05 | 4.19 | 0.6 | 1.9632E6 |  |
 |
8.6864E5 | 2.3001E6 | 2.721E6 | 3.13 | 1 | 430 | 442 | |
| K.TQQTSPDKVDYEYSELLLYQNQVLR.E | Y | Y | 7.66 | 1.36 | 1.7 | 1.8728E6 |  |
 |
2.2374E6 | 2.0705E6 | 1.3106E6 | 1.71 | 1 | 177 | 201 | |
| R.SYVDLLK.L | N | Y | 5.10 | 2.04 | 0.8 | 1.7545E6 |  |
 |
1.1777E6 | 2.1002E6 | 1.9856E6 | 1.78 | 1 | 537 | 543 | |
| K.LHDNPLTDENKEHEADTANMSDK.E | N | Y | 19.03 | 1.43 | 0.8 | 1.2909E6 |  |
 |
1.1619E6 | 1.619E6 | 1.4965E6 | 1.39 | 1 | 568 | 590 | |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.GLFIIDPNGVIK.H | Y | Y | 6.56 | 2.20 | 0.6 | 7.0116E6 |  |
 |
4.1404E6 | 8.095E6 | 8.7995E6 | 2.13 | 1 | 186 | 197 | |
| K.HLSVNDLPVGR.S | Y | Y | 4.11 | 2.96 | 3.5 | 1.9501E6 |  |
 |
1.0958E6 | 2.1115E6 | 2.6429E6 | 2.41 | 1 | 198 | 208 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.GLFIIDPNGVIK.H | Y | Y | 6.56 | 2.20 | 0.6 | 7.0116E6 | |
|
4.1404E6 | 8.095E6 | 8.7995E6 | 2.13 | 1 | 196 | 207 | |
| K.HLSVNDLPVGR.S | Y | Y | 4.11 | 2.96 | 3.5 | 1.9501E6 | |
|
1.0958E6 | 2.1115E6 | 2.6429E6 | 2.41 | 1 | 208 | 218 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NENTFLDLTVQQIEHLNK.T | Y | Y | 5.10 | 7.77 | 0.7 | 3.6618E6 |  |
 |
7.758E6 | 1.7884E6 | 1.439E6 | 5.39 | 1 | 134 | 151 | |
| R.EFPTVPLVK.L | Y | Y | 4.35 | 0.39 | 2.1 | 3.577E6 |  |
 |
3.8791E6 | 3.3078E6 | 3.5441E6 | 1.17 | 1 | 423 | 431 | |
| K.SFENSLGINVPR.S | Y | Y | 5.26 | 4.09 | 4.5 | 2.5392E6 |  |
 |
4.3463E6 | 1.0867E6 | 2.1846E6 | 4.00 | 1 | 378 | 389 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NENTFLDLTVQQIEHLNK.T | Y | Y | 5.10 | 7.77 | 0.7 | 3.6618E6 | |
|
7.758E6 | 1.7884E6 | 1.439E6 | 5.39 | 1 | 134 | 151 | |
| R.EFPTVPLVK.L | Y | Y | 4.35 | 0.39 | 2.1 | 3.577E6 | |
|
3.8791E6 | 3.3078E6 | 3.5441E6 | 1.17 | 1 | 423 | 431 | |
| K.SFENSLGINVPR.S | Y | Y | 5.26 | 4.09 | 4.5 | 2.5392E6 | |
|
4.3463E6 | 1.0867E6 | 2.1846E6 | 4.00 | 1 | 378 | 389 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NENTFLDLTVQQIEHLNK.T | Y | Y | 5.10 | 7.77 | 0.7 | 3.6618E6 | |
|
7.758E6 | 1.7884E6 | 1.439E6 | 5.39 | 1 | 134 | 151 | |
| R.EFPTVPLVK.L | Y | Y | 4.35 | 0.39 | 2.1 | 3.577E6 | |
|
3.8791E6 | 3.3078E6 | 3.5441E6 | 1.17 | 1 | 423 | 431 | |
| K.SFENSLGINVPR.S | Y | Y | 5.26 | 4.09 | 4.5 | 2.5392E6 | |
|
4.3463E6 | 1.0867E6 | 2.1846E6 | 4.00 | 1 | 378 | 389 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VLSVPESTPFTAVLK.F | Y | Y | 5.07 | 2.37 | 7.8 | 5.122E6 | |
|
7.8477E6 | 4.2051E6 | 3.3132E6 | 2.37 | 1 | 20 | 34 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VLQALGSEPIQYAVPVVK.Y | Y | Y | 8.50 | 4.02 | 0.7 | 6.7061E5 |  |
 |
1.2295E6 | 3.3153E5 | 4.5085E5 | 3.71 | 1 | 891 | 908 | |
| R.TSFLLNLR.R | Y | Y | 4.17 | 2.19 | 4.1 | 4.3187E5 |  |
 |
6.6433E5 | 2.4833E5 | 3.8295E5 | 2.68 | 1 | 795 | 802 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ALTSQLTDEELAQGR.L | Y | Y | 5.97 | 2.43 | 0.6 | 4.4181E6 |  |
 |
6.5422E6 | 3.1518E6 | 3.5603E6 | 2.08 | 1 | 497 | 511 | |
| R.NTLIQFEDFGNHNAFR.F | Y | Y | 7.57 | 2.42 | 0.8 | 2.0589E6 |  |
 |
3.0604E6 | 1.3701E6 | 1.7462E6 | 2.23 | 1 | 249 | 264 | |
| K.DPFYMGLYQK.R | Y | Y | 3.84 | 1.05 | 0.9 | 9.4909E5 |  |
 |
1.109E6 | 5.9782E5 | 1.1405E6 | 1.91 | 1 | 215 | 224 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ALTSQLTDEELAQGR.L | Y | Y | 5.97 | 2.43 | 0.6 | 4.4181E6 | |
|
6.5422E6 | 3.1518E6 | 3.5603E6 | 2.08 | 1 | 504 | 518 | |
| R.NTLIQFEDFGNHNAFR.F | Y | Y | 7.57 | 2.42 | 0.8 | 2.0589E6 | |
|
3.0604E6 | 1.3701E6 | 1.7462E6 | 2.23 | 1 | 256 | 271 | |
| K.DPFYMGLYQK.R | Y | Y | 3.84 | 1.05 | 0.9 | 9.4909E5 | |
|
1.109E6 | 5.9782E5 | 1.1405E6 | 1.91 | 1 | 222 | 231 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VAEC(+57.02)STGTLDYILQR.C | Y | Y | 6.95 | 4.81 | 2.7 | 1.8959E6 |  |
|
3.2619E6 | 1.0464E6 | 1.3794E6 | 3.12 | 1 | 320 | 334 | Carbamidomethylation |
| R.LFTVPWPVK.G | Y | Y | 5.50 | 0.99 | 0.5 | 6.9709E5 |  |
 |
6.9001E5 | 5.8446E5 | 8.168E5 | 1.40 | 1 | 113 | 121 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VAEC(+57.02)STGTLDYILQR.C | Y | Y | 6.95 | 4.81 | 2.7 | 1.8959E6 | |
|
3.2619E6 | 1.0464E6 | 1.3794E6 | 3.12 | 1 | 330 | 344 | Carbamidomethylation |
| R.LFTVPWPVK.G | Y | Y | 5.50 | 0.99 | 0.5 | 6.9709E5 | |
|
6.9001E5 | 5.8446E5 | 8.168E5 | 1.40 | 1 | 123 | 131 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.GAVLPHFNVLFDGLSK.L | Y | Y | 7.64 | 3.40 | 0.7 | 3.6278E5 | |
|
6.3413E5 | 2.2066E5 | 2.3354E5 | 2.87 | 1 | 126 | 141 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LEAMC(+57.02)FDGVK.R | Y | Y | 4.71 | 4.70 | 4.7 | 7.3009E6 |  |
 |
2.6452E6 | 8.2005E6 | 1.1057E7 | 4.18 | 1 | 42 | 51 | Carbamidomethylation |
| K.EDGQEYAQVIK.M | Y | Y | 5.20 | 3.60 | 4.2 | 5.7666E6 |  |
 |
3.404E6 | 4.3471E6 | 9.5487E6 | 2.81 | 1 | 25 | 35 | |
| K.AYGELPEHAK.I | Y | Y | 5.25 | 2.67 | 0.7 | 9.2895E6 |  |
 |
6.2106E6 | 1.0574E7 | 1.3727E7 | 2.21 | 2 | 100 | 109 | |
| R.ELVFKEDGQEYAQVIK.M | N | Y | 6.75 | 2.59 | 0.8 | 2.7614E6 |  |
 |
2.1752E6 | 1.8552E6 | 4.2538E6 | 2.29 | 1 | 20 | 35 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LEAMC(+57.02)FDGVK.R | Y | Y | 4.71 | 4.70 | 4.7 | 7.3009E6 | |
|
2.6452E6 | 8.2005E6 | 1.1057E7 | 4.18 | 1 | 47 | 56 | Carbamidomethylation |
| K.EDGQEYAQVIK.M | Y | Y | 5.20 | 3.60 | 4.2 | 5.7666E6 | |
|
3.404E6 | 4.3471E6 | 9.5487E6 | 2.81 | 1 | 30 | 40 | |
| K.AYGELPEHAK.I | Y | Y | 5.25 | 2.67 | 0.7 | 9.2895E6 | |
|
6.2106E6 | 1.0574E7 | 1.3727E7 | 2.21 | 2 | 105 | 114 | |
| R.ELVFKEDGQEYAQVIK.M | N | Y | 6.75 | 2.59 | 0.8 | 2.7614E6 | |
|
2.1752E6 | 1.8552E6 | 4.2538E6 | 2.29 | 1 | 25 | 40 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AATGEEVSAEDLGGADLHC(+57.02)R.R | Y | Y | 10.61 | 2.80 | 0.7 | 2.9969E6 |  |
|
1.582E6 | 3.7123E6 | 3.6963E6 | 2.35 | 1 | 249 | 268 | Carbamidomethylation |
| R.QGTIFLAGPPLVK.A | Y | Y | 6.51 | 1.58 | 0.5 | 9.3955E5 |  |
 |
6.7026E5 | 1.0641E6 | 1.0843E6 | 1.62 | 1 | 236 | 248 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AATGEEVSAEDLGGADLHC(+57.02)R.R | Y | Y | 10.61 | 2.80 | 0.7 | 2.9969E6 | |
|
1.582E6 | 3.7123E6 | 3.6963E6 | 2.35 | 1 | 249 | 268 | Carbamidomethylation |
| R.QGTIFLAGPPLVK.A | Y | Y | 6.51 | 1.58 | 0.5 | 9.3955E5 | |
|
6.7026E5 | 1.0641E6 | 1.0843E6 | 1.62 | 1 | 236 | 248 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VTADVTSAVMGNPVTR.E | Y | Y | 12.04 | 2.76 | 3.5 | 4.7338E5 | |
|
7.1298E5 | 3.2621E5 | 3.8096E5 | 2.19 | 1 | 15 | 30 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M.A(+42.01)GLNSLEAVK.R | Y | Y | 5.35 | 2.94 | 0.7 | 7.8854E6 |  |
 |
1.2692E7 | 5.4561E6 | 5.5081E6 | 2.33 | 1 | 2 | 11 | Acetylation (N-term) |
| K.YSEKEDKYEEEIK.L | Y | Y | 5.73 | 3.58 | 0.6 | 4.1432E6 |  |
 |
7.1951E6 | 2.8067E6 | 3.1295E6 | 2.56 | 1 | 178 | 190 | |
| K.EENVGLHQTLDQTLNELNC(+57.02)I | Y | Y | 5.77 | 1.32 | 0.8 | 3.7298E6 |  |
 |
4.4327E6 | 3.8472E6 | 2.9095E6 | 1.52 | 1 | 229 | 248 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.QIQEEITGNTEALSGR.H | Y | Y | 14.70 | 10.72 | 1.1 | 2.6652E5 | |
|
6.2159E5 | 1.0509E5 | 9.9152E4 | 6.27 | 1 | 229 | 244 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.HDIAFVEFENDGQAGAAR.D | Y | Y | 7.10 | 2.38 | 1.1 | 4.7731E6 | |
|
2.7404E6 | 5.6646E6 | 5.9532E6 | 2.17 | 2 | 177 | 194 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.KDDEENYLDLFSHK.N | Y | Y | 9.52 | 2.27 | 0.7 | 1.5532E7 | |
|
7.6048E6 | 2.0552E7 | 1.8538E7 | 2.70 | 2 | 139 | 152 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NLAMGVNLTSMSK.I | Y | Y | 3.93 | 0.70 | 1.1 | 2.2059E7 |  |
 |
1.9304E7 | 1.8632E7 | 2.8241E7 | 1.52 | 1 | 65 | 77 | |
| K.MPSGEFAR.I | N | Y | 4.60 | 4.06 | 0.7 | 1.9334E7 |  |
 |
1.0499E7 | 2.3671E7 | 2.9751E7 | 2.83 | 1 | 139 | 146 | |
| R.SEGFDTYR.C | N | Y | 5.18 | 3.50 | 0.5 | 1.9308E7 |  |
 |
9.5216E6 | 2.3368E7 | 3.0875E7 | 3.24 | 1 | 54 | 61 | |
| R.DLSHIGDAVVISC(+57.02)AK.D | Y | Y | 5.60 | 6.94 | 0.8 | 2.4827E7 |  |
 |
1.0276E7 | 2.8342E7 | 3.5862E7 | 3.49 | 2 | 150 | 164 | Carbamidomethylation |
| R.YLNFFTK.A | N | Y | 4.80 | 13.27 | 0.6 | 1.4293E7 |  |
 |
2.3124E6 | 1.6517E7 | 2.4049E7 | 10.40 | 1 | 211 | 217 | |
| K.C(+57.02)AGNEDIITLR.A | N | Y | 3.83 | 1.13 | 0.6 | 1.0114E7 |  |
 |
6.6624E6 | 1.0625E7 | 1.3056E7 | 1.96 | 1 | 81 | 91 | Carbamidomethylation |
| K.LMDLDVEQLGIPEQEYSC(+57.02)VVK.M | N | Y | 4.61 | 3.06 | 2.0 | 1.4533E7 |  |
 |
1.0717E7 | 2.381E7 | 1.5599E7 | 2.22 | 2 | 118 | 138 | Carbamidomethylation |
| R.AEDNADTLALVFEAPNQEK.V | Y | Y | 5.71 | 2.24 | 0.6 | 2.8601E7 |  |
|
1.8119E7 | 3.1246E7 | 3.644E7 | 2.01 | 2 | 92 | 110 | |
| K.FSASGELGNGNIK.L | N | Y | 3.96 | 5.29 | 2.5 | 4.4857E6 |  |
 |
1.2418E6 | 4.3102E6 | 8.2155E6 | 6.62 | 1 | 169 | 181 | |
| K.LM(+15.99)DLDVEQLGIPEQEYSC(+57.02)VVK.M | N | Y | 5.23 | 5.31 | 1.9 | 1.0474E6 |  |
 |
3.8778E5 | 1.2978E6 | 1.4567E6 | 3.76 | 1 | 118 | 138 | Oxidation (M); Carbamidomethylation |
| total 10 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ASSGLLYPLER.G | Y | Y | 4.23 | 1.12 | 3.2 | 1.4448E7 |  |
 |
1.1243E7 | 1.885E7 | 1.3249E7 | 1.68 | 1 | 347 | 357 | |
| K.VDNIQAGELTEGIWR.R | Y | Y | 4.81 | 4.78 | 1.4 | 6.3992E6 |  |
 |
2.987E6 | 9.102E6 | 7.1087E6 | 3.05 | 1 | 40 | 54 | |
| K.IPYTTVLR.L | N | Y | 4.57 | 2.94 | 2.6 | 4.7941E6 |  |
 |
2.2682E6 | 5.9995E6 | 6.1147E6 | 2.70 | 1 | 234 | 241 | |
| R.SFDFEIETK.Q | N | Y | 5.11 | 2.68 | 0.5 | 4.4724E6 |  |
 |
2.3948E6 | 5.9112E6 | 5.1112E6 | 2.47 | 1 | 388 | 396 | |
| K.ITVPGNFQGHSGAQC(+57.02)ITC(+57.02)SYK.A | N | Y | 17.08 | 6.26 | 0.9 | 3.7458E6 |  |
 |
1.8426E6 | 5.1664E6 | 4.2285E6 | 2.80 | 1 | 326 | 346 | Carbamidomethylation |
| R.FDEISFVNFAR.G | N | Y | 4.08 | 3.73 | 2.3 | 3.4E6 |  |
|
1.3111E6 | 5.2903E6 | 3.9266E6 | 4.04 | 1 | 371 | 381 | |
| K.QGTQYTFSSIER.E | N | Y | 6.68 | 2.57 | 0.6 | 2.7071E6 |  |
 |
1.729E6 | 3.3734E6 | 3.0189E6 | 1.95 | 1 | 397 | 408 | |
| K.ADVIQATGDAIC(+57.02)IFR.E | Y | Y | 6.17 | 5.10 | 1.2 | 6.4549E6 |  |
 |
3.577E6 | 9.2184E6 | 6.5693E6 | 2.58 | 2 | 189 | 203 | Carbamidomethylation |
| total 8 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ASSGLLYPLER.G | Y | Y | 4.23 | 1.12 | 3.2 | 1.4448E7 | |
|
1.1243E7 | 1.885E7 | 1.3249E7 | 1.68 | 1 | 440 | 450 | |
| K.VDNIQAGELTEGIWR.R | Y | Y | 4.81 | 4.78 | 1.4 | 6.3992E6 | |
|
2.987E6 | 9.102E6 | 7.1087E6 | 3.05 | 1 | 133 | 147 | |
| K.IPYTTVLR.L | N | Y | 4.57 | 2.94 | 2.6 | 4.7941E6 | |
|
2.2682E6 | 5.9995E6 | 6.1147E6 | 2.70 | 1 | 327 | 334 | |
| R.SFDFEIETK.Q | N | Y | 5.11 | 2.68 | 0.5 | 4.4724E6 | |
|
2.3948E6 | 5.9112E6 | 5.1112E6 | 2.47 | 1 | 481 | 489 | |
| K.ITVPGNFQGHSGAQC(+57.02)ITC(+57.02)SYK.A | N | Y | 17.08 | 6.26 | 0.9 | 3.7458E6 | |
|
1.8426E6 | 5.1664E6 | 4.2285E6 | 2.80 | 1 | 419 | 439 | Carbamidomethylation |
| R.FDEISFVNFAR.G | N | Y | 4.08 | 3.73 | 2.3 | 3.4E6 | |
|
1.3111E6 | 5.2903E6 | 3.9266E6 | 4.04 | 1 | 464 | 474 | |
| K.QGTQYTFSSIER.E | N | Y | 6.68 | 2.57 | 0.6 | 2.7071E6 | |
|
1.729E6 | 3.3734E6 | 3.0189E6 | 1.95 | 1 | 490 | 501 | |
| K.ADVIQATGDAIC(+57.02)IFR.E | Y | Y | 6.17 | 5.10 | 1.2 | 6.4549E6 | |
|
3.577E6 | 9.2184E6 | 6.5693E6 | 2.58 | 2 | 282 | 296 | Carbamidomethylation |
| total 8 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ASSGLLYPLER.G | Y | Y | 4.23 | 1.12 | 3.2 | 1.4448E7 | |
|
1.1243E7 | 1.885E7 | 1.3249E7 | 1.68 | 1 | 446 | 456 | |
| K.VDNIQAGELTEGIWR.R | Y | Y | 4.81 | 4.78 | 1.4 | 6.3992E6 | |
|
2.987E6 | 9.102E6 | 7.1087E6 | 3.05 | 1 | 139 | 153 | |
| K.IPYTTVLR.L | N | Y | 4.57 | 2.94 | 2.6 | 4.7941E6 | |
|
2.2682E6 | 5.9995E6 | 6.1147E6 | 2.70 | 1 | 333 | 340 | |
| R.SFDFEIETK.Q | N | Y | 5.11 | 2.68 | 0.5 | 4.4724E6 | |
|
2.3948E6 | 5.9112E6 | 5.1112E6 | 2.47 | 1 | 487 | 495 | |
| K.ITVPGNFQGHSGAQC(+57.02)ITC(+57.02)SYK.A | N | Y | 17.08 | 6.26 | 0.9 | 3.7458E6 | |
|
1.8426E6 | 5.1664E6 | 4.2285E6 | 2.80 | 1 | 425 | 445 | Carbamidomethylation |
| R.FDEISFVNFAR.G | N | Y | 4.08 | 3.73 | 2.3 | 3.4E6 | |
|
1.3111E6 | 5.2903E6 | 3.9266E6 | 4.04 | 1 | 470 | 480 | |
| K.QGTQYTFSSIER.E | N | Y | 6.68 | 2.57 | 0.6 | 2.7071E6 | |
|
1.729E6 | 3.3734E6 | 3.0189E6 | 1.95 | 1 | 496 | 507 | |
| K.ADVIQATGDAIC(+57.02)IFR.E | Y | Y | 6.17 | 5.10 | 1.2 | 6.4549E6 | |
|
3.577E6 | 9.2184E6 | 6.5693E6 | 2.58 | 2 | 288 | 302 | Carbamidomethylation |
| total 8 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SVLHEVMEQQTLSIAK.A | Y | Y | 6.90 | 3.62 | 1.1 | 1.7355E6 | |
|
9.6899E5 | 1.8989E6 | 2.3386E6 | 2.41 | 1 | 584 | 599 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NTQIIIQEESGIPK.V | Y | Y | 10.16 | 5.79 | 0.6 | 6.5244E5 | |
|
2.2875E5 | 7.4629E5 | 9.823E5 | 4.29 | 1 | 490 | 503 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NTQIIIQEESGIPK.V | Y | Y | 10.16 | 5.79 | 0.6 | 6.5244E5 | |
|
2.2875E5 | 7.4629E5 | 9.823E5 | 4.29 | 1 | 429 | 442 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AIGAVPLIQGEYMIPC(+57.02)EK.V | Y | Y | 5.56 | 2.81 | 0.8 | 5.8205E6 | |
|
8.7873E6 | 4.5037E6 | 4.1705E6 | 2.11 | 1 | 309 | 326 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AIGAVPLIQGEYMIPC(+57.02)EK.V | Y | Y | 5.56 | 2.81 | 0.8 | 5.8205E6 | |
|
8.7873E6 | 4.5037E6 | 4.1705E6 | 2.11 | 1 | 307 | 324 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AIGAVPLIQGEYMIPC(+57.02)EK.V | Y | Y | 5.56 | 2.81 | 0.8 | 5.8205E6 | |
|
8.7873E6 | 4.5037E6 | 4.1705E6 | 2.11 | 1 | 309 | 326 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VAAPEIVSGVSGESEQK.L | Y | Y | 10.90 | 5.67 | 1.0 | 5.5542E5 | |
|
1.751E5 | 6.1444E5 | 8.7674E5 | 5.01 | 1 | 311 | 327 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VAAPEIVSGVSGESEQK.L | Y | Y | 10.90 | 5.67 | 1.0 | 5.5542E5 | |
|
1.751E5 | 6.1444E5 | 8.7674E5 | 5.01 | 1 | 328 | 344 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IIFVVGGPGSGK.G | Y | Y | 5.25 | 2.32 | 1.0 | 4.9593E6 |  |
|
7.4693E6 | 3.6631E6 | 3.7454E6 | 2.04 | 1 | 10 | 21 | |
| K.YGYTHLSTGDLLR.A | Y | Y | 7.18 | 2.07 | 0.7 | 3.5304E6 |  |
 |
5.1077E6 | 2.5248E6 | 2.9588E6 | 2.02 | 1 | 32 | 44 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IIFVVGGPGSGK.G | Y | Y | 5.25 | 2.32 | 1.0 | 4.9593E6 | |
|
7.4693E6 | 3.6631E6 | 3.7454E6 | 2.04 | 1 | 26 | 37 | |
| K.YGYTHLSTGDLLR.A | Y | Y | 7.18 | 2.07 | 0.7 | 3.5304E6 | |
|
5.1077E6 | 2.5248E6 | 2.9588E6 | 2.02 | 1 | 48 | 60 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AGQSVIGLQMGTNK.C | Y | Y | 7.25 | 7.68 | 1.0 | 9.8978E5 |  |
 |
2.6816E5 | 1.5788E6 | 1.1223E6 | 5.89 | 1 | 113 | 126 | |
| K.LTLQPVDNSTISLQMGTNK.V | Y | Y | 8.38 | 2.46 | 9.2 | 8.1289E5 |  |
 |
4.3793E5 | 9.2407E5 | 1.0767E6 | 2.46 | 1 | 187 | 205 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.AGQSVIGLQMGTNK.C | Y | Y | 7.25 | 7.68 | 1.0 | 9.8978E5 | |
|
2.6816E5 | 1.5788E6 | 1.1223E6 | 5.89 | 1 | 159 | 172 | |
| K.LTLQPVDNSTISLQMGTNK.V | Y | Y | 8.38 | 2.46 | 9.2 | 8.1289E5 | |
|
4.3793E5 | 9.2407E5 | 1.0767E6 | 2.46 | 1 | 233 | 251 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SFMESGGTVLSTNWSDVGK.R | Y | Y | 6.34 | 5.24 | 2.8 | 1.2679E6 |  |
 |
2.7558E6 | 5.072E5 | 5.4071E5 | 5.43 | 1 | 302 | 320 | |
| K.LVGEIKEEEKNEK.L | Y | Y | 12.18 | 3.36 | 0.7 | 7.629E5 |  |
 |
1.2891E6 | 4.8716E5 | 6.3423E5 | 2.65 | 1 | 261 | 273 | |
| K.LFQQIYSDGSDEVK.R | Y | Y | 10.26 | 0.98 | 7.4 | 5.6132E5 |  |
 |
6.7532E5 | 4.9867E5 | 5.0995E5 | 1.35 | 1 | 283 | 296 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ALADVEVTYTVQR.N | Y | Y | 6.52 | 5.21 | 0.4 | 3.3863E6 |  |
 |
5.9228E6 | 1.7984E6 | 2.4377E6 | 3.29 | 1 | 67 | 79 | |
| K.YGHAAC(+57.02)FGLQPGC(+57.02)LR.Q | Y | Y | 6.50 | 1.66 | 2.8 | 2.5344E6 |  |
 |
2.9861E6 | 1.8407E6 | 2.7763E6 | 1.62 | 1 | 422 | 436 | Carbamidomethylation |
| R.YYMNQVEETR.Y | Y | Y | 5.27 | 4.88 | 2.8 | 1.2397E6 |  |
 |
2.052E6 | 5.4059E5 | 1.1267E6 | 3.80 | 1 | 339 | 348 | |
| K.LSEFDVEMSMR.Q | N | Y | 8.58 | 1.79 | 0.9 | 4.4856E5 |  |
 |
6.4014E5 | 2.82E5 | 4.2355E5 | 2.27 | 1 | 105 | 115 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.TVGIDDLTGEPLIQR.E | Y | Y | 5.78 | 3.25 | 0.7 | 2.5143E6 | |
|
3.8066E6 | 1.3858E6 | 2.3506E6 | 2.75 | 1 | 147 | 161 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.MLAEDELR.D | Y | Y | 4.97 | 0.85 | 0.7 | 3.4733E7 |  |
 |
3.4586E7 | 3.0804E7 | 3.8808E7 | 1.26 | 1 | 110 | 117 | |
| K.NISFTVWDVGGQDK.I | Y | Y | 4.27 | 3.92 | 1.1 | 3.0792E7 |  |
 |
6.0958E7 | 1.4354E7 | 1.7062E7 | 4.25 | 1 | 60 | 73 | |
| K.QDLPNAMNAAEITDK.L | Y | Y | 6.08 | 3.33 | 0.7 | 1.6027E7 |  |
 |
2.0893E7 | 1.1122E7 | 1.6066E7 | 1.88 | 1 | 128 | 142 | |
| K.QDLPNAM(+15.99)NAAEITDK.L | N | Y | 6.00 | 4.09 | 1.1 | 1.0399E6 |  |
 |
1.7828E6 | 5.3027E5 | 8.0658E5 | 3.36 | 1 | 128 | 142 | Oxidation (M) |
| R.M(+15.99)LAEDELR.D | N | Y | 4.61 | 1.86 | 0.9 | 2.1979E4 |  |
 |
4.2746E4 | 3.4419E4 | 5.8345E4 | 1.70 | 1 | 110 | 117 | Oxidation (M) |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IIVLGLLPR.G | Y | Y | 5.68 | 3.04 | 0.6 | 5.8838E6 |  |
 |
9.036E6 | 4.2263E6 | 4.389E6 | 2.14 | 1 | 134 | 142 | |
| R.ELFSPLHALNFGIGGDTTR.H | Y | Y | 5.00 | 0.71 | 0.9 | 5.4234E6 |  |
 |
6.3296E6 | 4.8578E6 | 5.0827E6 | 1.30 | 1 | 61 | 79 | |
| M.S(+42.01)QGDSNPAAIPHAAEDIQGDDR.W | Y | Y | 8.94 | 5.24 | 1.1 | 6.9234E6 |  |
 |
1.2633E7 | 3.7523E6 | 4.3844E6 | 3.37 | 2 | 2 | 23 | Acetylation (N-term) |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ARDDLITDLLNEAK.Q | Y | Y | 5.28 | 7.09 | 0.7 | 1.4516E6 | |
|
2.698E6 | 6.928E5 | 9.639E5 | 3.89 | 1 | 86 | 99 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LAQIHIQQQDQC(+57.02)VEITEESK.A | Y | Y | 11.77 | 2.75 | 0.7 | 2.4495E6 | |
|
3.5123E6 | 1.7514E6 | 2.0847E6 | 2.01 | 1 | 129 | 148 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LAQIHIQQQDQC(+57.02)VEITEESK.A | Y | Y | 11.77 | 2.75 | 0.7 | 2.4495E6 | |
|
3.5123E6 | 1.7514E6 | 2.0847E6 | 2.01 | 1 | 129 | 148 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NC(+57.02)PHVVVGTPGR.I | Y | Y | 5.19 | 2.20 | 0.6 | 3.3089E6 |  |
 |
2.613E6 | 3.7635E6 | 4.4909E6 | 1.72 | 1 | 163 | 174 | Carbamidomethylation |
| K.HFVLDEC(+57.02)DK.M | Y | Y | 6.06 | 7.09 | 0.8 | 2.1655E6 |  |
 |
9.544E5 | 2.5324E6 | 3.6427E6 | 3.82 | 1 | 191 | 199 | Carbamidomethylation |
| K.VSVFFGGLSIK.K | Y | Y | 6.05 | 0.78 | 0.7 | 7.6555E5 |  |
 |
6.9619E5 | 8.9497E5 | 7.0548E5 | 1.29 | 1 | 144 | 154 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NC(+57.02)PHVVVGTPGR.I | Y | Y | 5.19 | 2.20 | 0.6 | 3.3089E6 | |
|
2.613E6 | 3.7635E6 | 4.4909E6 | 1.72 | 1 | 163 | 174 | Carbamidomethylation |
| K.HFVLDEC(+57.02)DK.M | Y | Y | 6.06 | 7.09 | 0.8 | 2.1655E6 | |
|
9.544E5 | 2.5324E6 | 3.6427E6 | 3.82 | 1 | 191 | 199 | Carbamidomethylation |
| K.VSVFFGGLSIK.K | Y | Y | 6.05 | 0.78 | 0.7 | 7.6555E5 | |
|
6.9619E5 | 8.9497E5 | 7.0548E5 | 1.29 | 1 | 144 | 154 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NC(+57.02)PHVVVGTPGR.I | Y | Y | 5.19 | 2.20 | 0.6 | 3.3089E6 | |
|
2.613E6 | 3.7635E6 | 4.4909E6 | 1.72 | 1 | 163 | 174 | Carbamidomethylation |
| K.HFVLDEC(+57.02)DK.M | Y | Y | 6.06 | 7.09 | 0.8 | 2.1655E6 | |
|
9.544E5 | 2.5324E6 | 3.6427E6 | 3.82 | 1 | 191 | 199 | Carbamidomethylation |
| K.VSVFFGGLSIK.K | Y | Y | 6.05 | 0.78 | 0.7 | 7.6555E5 | |
|
6.9619E5 | 8.9497E5 | 7.0548E5 | 1.29 | 1 | 144 | 154 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.YQSHDYAFSSVEK.L | Y | Y | 6.06 | 5.51 | 0.9 | 1.63E6 | |
|
3.1225E6 | 9.3354E5 | 1.3006E6 | 3.34 | 1 | 156 | 168 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.YQSHDYAFSSVEK.L | Y | Y | 6.06 | 5.51 | 0.9 | 1.63E6 | |
|
3.1225E6 | 9.3354E5 | 1.3006E6 | 3.34 | 1 | 169 | 181 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VDLVDENFTELR.G | Y | Y | 4.92 | 1.54 | 0.4 | 6.0447E6 |  |
 |
4.5715E6 | 5.9466E6 | 7.616E6 | 1.67 | 1 | 29 | 40 | |
| K.IPETYPFNPPK.Y | Y | Y | 3.51 | 4.78 | 0.9 | 5.985E6 |  |
 |
1.1234E6 | 7.0646E6 | 1.0048E7 | 8.94 | 1 | 62 | 72 | |
| R.GEIAGPPDTPYEGGR.Y | Y | Y | 6.56 | 2.13 | 0.5 | 4.7948E6 |  |
 |
2.8957E6 | 5.8202E6 | 5.6685E6 | 2.01 | 1 | 41 | 55 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.YAQVKPDGTYVKPLSNK.L | Y | Y | 34.25 | 6.62 | 0.6 | 6.9786E5 | |
|
1.2648E6 | 3.7435E5 | 5.4799E5 | 3.38 | 1 | 256 | 272 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.YAQVKPDGTYVKPLSNK.L | Y | Y | 34.25 | 6.62 | 0.6 | 6.9786E5 | |
|
1.2648E6 | 3.7435E5 | 5.4799E5 | 3.38 | 1 | 255 | 271 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VMFSSFGQIEEC(+57.02)R.I | Y | Y | 6.24 | 4.68 | 0.6 | 1.3867E6 | |
|
7.0874E5 | 1.6569E6 | 1.7945E6 | 2.53 | 1 | 126 | 138 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VMFSSFGQIEEC(+57.02)R.I | Y | Y | 6.24 | 4.68 | 0.6 | 1.3867E6 | |
|
7.0874E5 | 1.6569E6 | 1.7945E6 | 2.53 | 1 | 126 | 138 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VMFSSFGQIEEC(+57.02)R.I | Y | Y | 6.24 | 4.68 | 0.6 | 1.3867E6 | |
|
7.0874E5 | 1.6569E6 | 1.7945E6 | 2.53 | 1 | 126 | 138 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VMFSSFGQIEEC(+57.02)R.I | Y | Y | 6.24 | 4.68 | 0.6 | 1.3867E6 | |
|
7.0874E5 | 1.6569E6 | 1.7945E6 | 2.53 | 1 | 126 | 138 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NDAPTPGTSTTPGLR.S | Y | Y | 5.82 | 7.59 | 1.0 | 1.0213E6 | |
|
6.3161E5 | 9.9276E5 | 1.6879E6 | 2.67 | 1 | 317 | 331 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NDAPTPGTSTTPGLR.S | Y | Y | 5.82 | 7.59 | 1.0 | 1.0213E6 | |
|
6.3161E5 | 9.9276E5 | 1.6879E6 | 2.67 | 1 | 314 | 328 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NDAPTPGTSTTPGLR.S | Y | Y | 5.82 | 7.59 | 1.0 | 1.0213E6 | |
|
6.3161E5 | 9.9276E5 | 1.6879E6 | 2.67 | 1 | 267 | 281 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NDAPTPGTSTTPGLR.S | Y | Y | 5.82 | 7.59 | 1.0 | 1.0213E6 | |
|
6.3161E5 | 9.9276E5 | 1.6879E6 | 2.67 | 1 | 308 | 322 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NDAPTPGTSTTPGLR.S | Y | Y | 5.82 | 7.59 | 1.0 | 1.0213E6 | |
|
6.3161E5 | 9.9276E5 | 1.6879E6 | 2.67 | 1 | 324 | 338 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LSVQGEVSTFTGK.L | Y | Y | 6.27 | 8.48 | 3.1 | 2.3314E6 |  |
 |
4.3987E6 | 1.2283E6 | 1.3673E6 | 3.58 | 1 | 177 | 189 | |
| K.FAEVYFAQSQQK.V | Y | Y | 4.85 | 1.91 | 0.8 | 2.1309E6 |  |
 |
2.9826E6 | 1.7644E6 | 1.6459E6 | 1.81 | 1 | 126 | 137 | |
| K.LYIEFVK.G | Y | Y | 5.16 | 1.58 | 2.7 | 7.5536E5 |  |
 |
6.1891E5 | 7.9465E5 | 8.525E5 | 1.38 | 1 | 190 | 196 | |
| K.VC(+57.02)ALYIMAGTVDDVPK.L | N | Y | 5.33 | 1.84 | 7.5 | 6.185E5 |  |
 |
5.148E5 | 7.9993E5 | 5.4078E5 | 1.55 | 1 | 204 | 219 | Carbamidomethylation |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IEVEQALAHPYLEQYYDPSDEPIAEAPFK.F | Y | Y | 14.24 | 2.86 | 1.2 | 3.172E6 |  |
 |
4.6096E6 | 2.1657E6 | 2.7408E6 | 2.13 | 1 | 300 | 328 | |
| R.VADPDHDHTGFLTEYVATR.W | Y | Y | 7.10 | 2.81 | 1.0 | 2.596E6 |  |
 |
3.7542E6 | 1.5323E6 | 2.5014E6 | 2.45 | 1 | 171 | 189 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.AFGYYGPLR.S | Y | Y | 5.12 | 17.48 | 0.5 | 2.3991E7 | |
|
1.6852E6 | 3.2333E7 | 3.7954E7 | 22.52 | 1 | 29 | 37 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.AFGYYGPLR.S | Y | Y | 5.12 | 17.48 | 0.5 | 2.3991E7 | |
|
1.6852E6 | 3.2333E7 | 3.7954E7 | 22.52 | 1 | 29 | 37 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.AFGYYGPLR.S | Y | Y | 5.12 | 17.48 | 0.5 | 2.3991E7 | |
|
1.6852E6 | 3.2333E7 | 3.7954E7 | 22.52 | 1 | 29 | 37 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.AFGYYGPLR.S | Y | Y | 5.12 | 17.48 | 0.5 | 2.3991E7 | |
|
1.6852E6 | 3.2333E7 | 3.7954E7 | 22.52 | 1 | 29 | 37 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VEQVLSLEPQHELK.F | Y | Y | 8.78 | 5.11 | 1.5 | 1.3765E7 | |
|
2.8033E7 | 6.7088E6 | 6.5536E6 | 4.28 | 2 | 4 | 17 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SLAMLGSSEDNTALSR.A | Y | Y | 5.76 | 6.44 | 1.1 | 1.3198E6 | |
|
1.9476E6 | 6.9927E5 | 1.3126E6 | 2.79 | 1 | 350 | 365 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SLAMLGSSEDNTALSR.A | Y | Y | 5.76 | 6.44 | 1.1 | 1.3198E6 | |
|
1.9476E6 | 6.9927E5 | 1.3126E6 | 2.79 | 1 | 350 | 365 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SLAMLGSSEDNTALSR.A | Y | Y | 5.76 | 6.44 | 1.1 | 1.3198E6 | |
|
1.9476E6 | 6.9927E5 | 1.3126E6 | 2.79 | 1 | 302 | 317 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NVSSFPDDATSPLQENR.N | Y | Y | 6.41 | 4.40 | 0.5 | 8.2592E6 | |
|
3.925E6 | 1.1049E7 | 9.803E6 | 2.82 | 1 | 52 | 68 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LASLTPGFSGADVANVC(+57.02)NEAALIAAR.H | Y | Y | 17.81 | 9.11 | 1.9 | 9.933E4 | |
|
5.4633E4 | 1.8794E5 | 8.2731E4 | 3.44 | 1 | 479 | 504 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LASLTPGFSGADVANVC(+57.02)NEAALIAAR.H | Y | Y | 17.81 | 9.11 | 1.9 | 9.933E4 | |
|
5.4633E4 | 1.8794E5 | 8.2731E4 | 3.44 | 1 | 508 | 533 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M.C(+57.02)(+42.01)DKEFMWALK.N | Y | Y | 5.40 | 2.28 | 4.8 | 4.0117E6 | |
|
3.0042E6 | 2.945E6 | 6.0859E6 | 2.07 | 1 | 2 | 11 | Carbamidomethylation; Acetylation (N-term) |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.EGPVQFEEDPFGLDK.F | Y | Y | 4.94 | 3.79 | 0.9 | 2.4953E6 |  |
 |
1.6001E6 | 2.5884E6 | 3.9445E6 | 2.47 | 1 | 489 | 503 | |
| R.LLEDFGDGGAFPEIHVAQYPLDMGR.K | Y | Y | 9.78 | 4.43 | 2.5 | 1.2564E6 |  |
 |
7.0315E5 | 2.451E6 | 8.2021E5 | 3.49 | 1 | 54 | 78 | |
| R.YTPSQQGVAFNSGAK.Q | Y | Y | 6.96 | 3.90 | 2.0 | 9.5007E5 |  |
 |
4.9689E5 | 1.4759E6 | 1.2464E6 | 2.97 | 1 | 179 | 193 | |
| K.GMDSGFAGGEDEIYNVYDQAWR.G | N | Y | 16.20 | 7.99 | 1.9 | 2.537E5 |  |
 |
7.77E4 | 4.0417E5 | 2.9866E5 | 5.20 | 1 | 417 | 438 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.EGPVQFEEDPFGLDK.F | Y | Y | 4.94 | 3.79 | 0.9 | 2.4953E6 | |
|
1.6001E6 | 2.5884E6 | 3.9445E6 | 2.47 | 1 | 489 | 503 | |
| R.LLEDFGDGGAFPEIHVAQYPLDMGR.K | Y | Y | 9.78 | 4.43 | 2.5 | 1.2564E6 | |
|
7.0315E5 | 2.451E6 | 8.2021E5 | 3.49 | 1 | 54 | 78 | |
| R.YTPSQQGVAFNSGAK.Q | Y | Y | 6.96 | 3.90 | 2.0 | 9.5007E5 | |
|
4.9689E5 | 1.4759E6 | 1.2464E6 | 2.97 | 1 | 179 | 193 | |
| K.GMDSGFAGGEDEIYNVYDQAWR.G | N | Y | 16.20 | 7.99 | 1.9 | 2.537E5 | |
|
7.77E4 | 4.0417E5 | 2.9866E5 | 5.20 | 1 | 417 | 438 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ELAPLQELIEK.L | Y | Y | 5.92 | 1.43 | 3.7 | 2.5453E6 |  |
 |
1.8296E6 | 2.6578E6 | 3.1485E6 | 1.72 | 1 | 199 | 209 | |
| K.HAEATLGSGNLR.Q | Y | Y | 3.43 | 6.41 | 4.3 | 8.2917E5 |  |
 |
1.1045E5 | 1.0619E6 | 1.6082E6 | 14.56 | 1 | 30 | 41 | |
| K.IGVPFPK.N | Y | Y | 4.02 | 1.87 | 1.1 | 5.1668E5 |  |
 |
2.8595E5 | 6.6494E5 | 6.7065E5 | 2.35 | 1 | 135 | 141 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ELAPLQELIEK.L | Y | Y | 5.92 | 1.43 | 3.7 | 2.5453E6 | |
|
1.8296E6 | 2.6578E6 | 3.1485E6 | 1.72 | 1 | 202 | 212 | |
| K.HAEATLGSGNLR.M | Y | Y | 3.43 | 6.41 | 4.3 | 8.2917E5 | |
|
1.1045E5 | 1.0619E6 | 1.6082E6 | 14.56 | 1 | 33 | 44 | |
| K.IGVPFPK.N | Y | Y | 4.02 | 1.87 | 1.1 | 5.1668E5 | |
|
2.8595E5 | 6.6494E5 | 6.7065E5 | 2.35 | 1 | 138 | 144 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ELAPLQELIEK.L | Y | Y | 5.92 | 1.43 | 3.7 | 2.5453E6 | |
|
1.8296E6 | 2.6578E6 | 3.1485E6 | 1.72 | 1 | 211 | 221 | |
| K.HAEATLGSGNLR.M | Y | Y | 3.43 | 6.41 | 4.3 | 8.2917E5 | |
|
1.1045E5 | 1.0619E6 | 1.6082E6 | 14.56 | 1 | 42 | 53 | |
| K.IGVPFPK.N | Y | Y | 4.02 | 1.87 | 1.1 | 5.1668E5 | |
|
2.8595E5 | 6.6494E5 | 6.7065E5 | 2.35 | 1 | 147 | 153 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.HAEATLGSGNLR.M | Y | Y | 3.43 | 6.41 | 4.3 | 8.2917E5 | |
|
1.1045E5 | 1.0619E6 | 1.6082E6 | 14.56 | 1 | 31 | 42 | |
| K.IGVPFPK.N | Y | Y | 4.02 | 1.87 | 1.1 | 5.1668E5 | |
|
2.8595E5 | 6.6494E5 | 6.7065E5 | 2.35 | 1 | 136 | 142 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ELAPLQELIEK.L | Y | Y | 5.92 | 1.43 | 3.7 | 2.5453E6 | |
|
1.8296E6 | 2.6578E6 | 3.1485E6 | 1.72 | 1 | 200 | 210 | |
| K.HAEATLGSGNLR.Q | Y | Y | 3.43 | 6.41 | 4.3 | 8.2917E5 | |
|
1.1045E5 | 1.0619E6 | 1.6082E6 | 14.56 | 1 | 31 | 42 | |
| K.IGVPFPK.N | Y | Y | 4.02 | 1.87 | 1.1 | 5.1668E5 | |
|
2.8595E5 | 6.6494E5 | 6.7065E5 | 2.35 | 1 | 136 | 142 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ELAPLQELIEK.L | Y | Y | 5.92 | 1.43 | 3.7 | 2.5453E6 | |
|
1.8296E6 | 2.6578E6 | 3.1485E6 | 1.72 | 1 | 200 | 210 | |
| K.HAEATLGSGNLR.Q | Y | Y | 3.43 | 6.41 | 4.3 | 8.2917E5 | |
|
1.1045E5 | 1.0619E6 | 1.6082E6 | 14.56 | 1 | 31 | 42 | |
| K.IGVPFPK.N | Y | Y | 4.02 | 1.87 | 1.1 | 5.1668E5 | |
|
2.8595E5 | 6.6494E5 | 6.7065E5 | 2.35 | 1 | 136 | 142 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IMEVIDAITTTAQSHQR.T | Y | Y | 3.41 | 2.64 | 0.8 | 2.6806E6 |  |
 |
4.6126E6 | 1.1976E6 | 2.2316E6 | 3.85 | 1 | 185 | 201 | |
| R.TNVLGHLQQGGAPTPFDR.N | Y | Y | 6.93 | 18.49 | 1.7 | 3.2518E5 |  |
 |
8.7119E5 | 5.1729E4 | 7.8484E4 | 16.84 | 1 | 655 | 672 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VPLALFALNR.Q | Y | Y | 4.79 | 3.33 | 1.9 | 1.3138E6 |  |
 |
7.1884E5 | 1.6399E6 | 1.5828E6 | 2.28 | 1 | 18 | 27 | |
| R.TVEEIEAC(+57.02)MAGC(+57.02)DK.A | Y | Y | 5.83 | 5.80 | 0.8 | 8.8728E5 |  |
 |
5.2856E5 | 1.0218E6 | 1.4819E6 | 2.80 | 1 | 471 | 484 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.TVQDALESLVAR.E | Y | Y | 4.59 | 3.63 | 0.7 | 1.9899E6 |  |
 |
1.3482E6 | 9.1327E5 | 3.7083E6 | 4.06 | 1 | 638 | 649 | |
| R.DIRPGAAFEPTYIYR.L | Y | Y | 5.85 | 1.44 | 1.3 | 1.076E6 |  |
 |
8.6262E5 | 1.0092E6 | 1.3561E6 | 1.57 | 1 | 488 | 502 | |
| R.QADFVQTPITGIFGGHIR.S | Y | Y | 10.56 | 1.78 | 2.0 | 5.3357E5 |  |
 |
6.1781E5 | 3.4515E5 | 6.3774E5 | 1.85 | 1 | 590 | 607 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.TVQDALESLVAR.E | Y | Y | 4.59 | 3.63 | 0.7 | 1.9899E6 | |
|
1.3482E6 | 9.1327E5 | 3.7083E6 | 4.06 | 1 | 639 | 650 | |
| R.DIRPGAAFEPTYIYR.L | Y | Y | 5.85 | 1.44 | 1.3 | 1.076E6 | |
|
8.6262E5 | 1.0092E6 | 1.3561E6 | 1.57 | 1 | 489 | 503 | |
| R.QADFVQTPITGIFGGHIR.S | Y | Y | 10.56 | 1.78 | 2.0 | 5.3357E5 | |
|
6.1781E5 | 3.4515E5 | 6.3774E5 | 1.85 | 1 | 591 | 608 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LITALGSSEVQPQFTR.F | Y | Y | 10.98 | 2.16 | 0.7 | 3.7818E5 |  |
 |
2.1774E5 | 4.4517E5 | 4.7162E5 | 2.17 | 1 | 652 | 667 | |
| K.TVLSAESEELNR.A | Y | Y | 11.16 | 2.57 | 1.3 | 3.4029E5 |  |
 |
1.9774E5 | 3.9E5 | 4.3314E5 | 2.19 | 1 | 674 | 685 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LITALGSSEVQPQFTR.F | Y | Y | 10.98 | 2.16 | 0.7 | 3.7818E5 | |
|
2.1774E5 | 4.4517E5 | 4.7162E5 | 2.17 | 1 | 655 | 670 | |
| K.TVLSAESEELNR.A | Y | Y | 11.16 | 2.57 | 1.3 | 3.4029E5 | |
|
1.9774E5 | 3.9E5 | 4.3314E5 | 2.19 | 1 | 677 | 688 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LITALGSSEVQPQFTR.F | Y | Y | 10.98 | 2.16 | 0.7 | 3.7818E5 | |
|
2.1774E5 | 4.4517E5 | 4.7162E5 | 2.17 | 1 | 661 | 676 | |
| K.TVLSAESEELNR.A | Y | Y | 11.16 | 2.57 | 1.3 | 3.4029E5 | |
|
1.9774E5 | 3.9E5 | 4.3314E5 | 2.19 | 1 | 683 | 694 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LITALGSSEVQPQFTR.F | Y | Y | 10.98 | 2.16 | 0.7 | 3.7818E5 | |
|
2.1774E5 | 4.4517E5 | 4.7162E5 | 2.17 | 1 | 652 | 667 | |
| K.TVLSAESEELNR.A | Y | Y | 11.16 | 2.57 | 1.3 | 3.4029E5 | |
|
1.9774E5 | 3.9E5 | 4.3314E5 | 2.19 | 1 | 674 | 685 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LLVLEDENANVDEVELKPDTLIK.L | Y | Y | 5.75 | 3.44 | 0.6 | 3.1057E6 | |
|
1.8912E6 | 3.4133E6 | 4.0125E6 | 2.12 | 1 | 640 | 662 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.EAAWAITNATSGGSAEQIK.Y | Y | Y | 15.12 | 8.58 | 0.8 | 5.0277E5 | |
|
1.4073E5 | 6.7622E5 | 6.9137E5 | 4.91 | 1 | 399 | 417 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.EAAWAITNATSGGSAEQIK.Y | Y | Y | 15.12 | 8.58 | 0.8 | 5.0277E5 | |
|
1.4073E5 | 6.7622E5 | 6.9137E5 | 4.91 | 1 | 399 | 417 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.EAAWAITNATSGGSAEQIK.Y | Y | Y | 15.12 | 8.58 | 0.8 | 5.0277E5 | |
|
1.4073E5 | 6.7622E5 | 6.9137E5 | 4.91 | 1 | 405 | 423 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.EAAWAITNATSGGSAEQIK.Y | Y | Y | 15.12 | 8.58 | 0.8 | 5.0277E5 | |
|
1.4073E5 | 6.7622E5 | 6.9137E5 | 4.91 | 1 | 408 | 426 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SSAVVVDAIPVFLEK.L | Y | Y | 3.67 | 2.81 | 1.7 | 1.8301E6 |  |
 |
3.2373E6 | 1.1776E6 | 1.0754E6 | 3.01 | 1 | 521 | 535 | |
| R.SIVSESDVSSFEIQHSGFVK.Q | Y | Y | 29.42 | 3.54 | 3.8 | 1.0071E6 |  |
 |
1.3565E6 | 6.3525E5 | 1.0296E6 | 2.14 | 1 | 1179 | 1198 | |
| R.LVDNFQHEENLLQQVASK.D | Y | Y | 8.56 | 1.29 | 0.5 | 9.6366E5 |  |
 |
1.2964E6 | 8.6248E5 | 7.3208E5 | 1.77 | 1 | 635 | 652 | |
| R.LLDTNPEINQSDSQDSR.V | N | Y | 17.21 | 3.02 | 1.1 | 4.4148E5 |  |
 |
5.7147E5 | 3.6387E5 | 3.8909E5 | 1.57 | 1 | 1598 | 1614 | |
| K.MADPEGNQETVNSSAAR.T | N | Y | 14.82 | 1.57 | 0.9 | 1.5098E5 |  |
 |
1.9694E5 | 1.6922E5 | 1.2907E5 | 1.53 | 1 | 356 | 372 | |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.TTLPTFQSPEFSVTR.Q | Y | Y | 6.45 | 1.71 | 1.2 | 2.3923E6 |  |
 |
1.7302E6 | 2.7063E6 | 2.7402E6 | 1.58 | 1 | 53 | 67 | |
| R.NNVSLLQSC(+57.02)IDLFK.N | Y | Y | 4.56 | 3.75 | 0.9 | 1.8148E6 |  |
 |
7.6314E5 | 2.6046E6 | 2.0765E6 | 3.41 | 1 | 389 | 402 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.TTLPTFQSPEFSVTR.Q | Y | Y | 6.45 | 1.71 | 1.2 | 2.3923E6 | |
|
1.7302E6 | 2.7063E6 | 2.7402E6 | 1.58 | 1 | 53 | 67 | |
| R.NNVSLLQSC(+57.02)IDLFK.N | Y | Y | 4.56 | 3.75 | 0.9 | 1.8148E6 | |
|
7.6314E5 | 2.6046E6 | 2.0765E6 | 3.41 | 1 | 369 | 382 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.EVENLILENTQLLETK.N | Y | Y | 6.28 | 2.97 | 0.9 | 6.798E5 |  |
 |
3.7006E5 | 8.6492E5 | 8.0443E5 | 2.34 | 1 | 399 | 414 | |
| K.YNAPTSHVTPSVK.K | Y | Y | 11.36 | 5.24 | 1.2 | 9.3192E4 |  |
 |
4.2833E4 | 1.0958E5 | 1.6526E5 | 3.86 | 1 | 568 | 580 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.EVENLILENTQLLETK.N | Y | Y | 6.28 | 2.97 | 0.9 | 6.798E5 | |
|
3.7006E5 | 8.6492E5 | 8.0443E5 | 2.34 | 1 | 413 | 428 | |
| K.YNAPTSHVTPSVK.K | Y | Y | 11.36 | 5.24 | 1.2 | 9.3192E4 | |
|
4.2833E4 | 1.0958E5 | 1.6526E5 | 3.86 | 1 | 582 | 594 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LALEQQQLIC(+57.02)K.Q | Y | Y | 4.86 | 6.55 | 0.6 | 3.5917E6 |  |
 |
1.5228E6 | 3.9059E6 | 5.3464E6 | 3.51 | 1 | 60 | 70 | Carbamidomethylation |
| R.ITADGAHFELR.L | Y | Y | 5.84 | 3.83 | 0.7 | 1.8918E6 |  |
 |
9.2676E5 | 2.2236E6 | 2.5249E6 | 2.72 | 1 | 201 | 211 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LALEQQQLIC(+57.02)K.Q | Y | Y | 4.86 | 6.55 | 0.6 | 3.5917E6 | |
|
1.5228E6 | 3.9059E6 | 5.3464E6 | 3.51 | 1 | 60 | 70 | Carbamidomethylation |
| R.ITADGAHFELR.L | Y | Y | 5.84 | 3.83 | 0.7 | 1.8918E6 | |
|
9.2676E5 | 2.2236E6 | 2.5249E6 | 2.72 | 1 | 201 | 211 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LALEQQQLIC(+57.02)K.Q | Y | Y | 4.86 | 6.55 | 0.6 | 3.5917E6 | |
|
1.5228E6 | 3.9059E6 | 5.3464E6 | 3.51 | 1 | 60 | 70 | Carbamidomethylation |
| R.ITADGAHFELR.L | Y | Y | 5.84 | 3.83 | 0.7 | 1.8918E6 | |
|
9.2676E5 | 2.2236E6 | 2.5249E6 | 2.72 | 1 | 201 | 211 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LQQELEAANQSLAELR.D | Y | Y | 6.97 | 7.89 | 1.8 | 2.7912E5 | |
|
6.3189E5 | 1.0087E5 | 1.5504E5 | 6.26 | 1 | 261 | 276 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ADVDVQPYAFTTK.S | Y | Y | 5.76 | 8.24 | 1.6 | 2.3154E6 | |
|
7.3466E5 | 3.1188E6 | 3.0928E6 | 4.25 | 1 | 191 | 203 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ADVDVQPYAFTTK.S | Y | Y | 5.76 | 8.24 | 1.6 | 2.3154E6 | |
|
7.3466E5 | 3.1188E6 | 3.0928E6 | 4.25 | 1 | 191 | 203 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ADVDVQPYAFTTK.S | Y | Y | 5.76 | 8.24 | 1.6 | 2.3154E6 | |
|
7.3466E5 | 3.1188E6 | 3.0928E6 | 4.25 | 1 | 191 | 203 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.ADVDVQPYAFTTK.S | Y | Y | 5.76 | 8.24 | 1.6 | 2.3154E6 | |
|
7.3466E5 | 3.1188E6 | 3.0928E6 | 4.25 | 1 | 191 | 203 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.YLGPAVLMQAYR.W | Y | Y | 4.51 | 2.90 | 6.6 | 1.8238E6 | |
|
8.6778E5 | 2.2422E6 | 2.3613E6 | 2.72 | 1 | 208 | 219 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IQTLPNQNQSQTQPLLK.T | Y | Y | 15.52 | 3.33 | 0.6 | 8.6716E5 | |
|
5.1768E5 | 9.7846E5 | 1.1053E6 | 2.14 | 1 | 191 | 207 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IQTLPNQNQSQTQPLLK.T | Y | Y | 15.52 | 3.33 | 0.6 | 8.6716E5 | |
|
5.1768E5 | 9.7846E5 | 1.1053E6 | 2.14 | 1 | 202 | 218 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NEINIDTLAR.D | Y | Y | 3.93 | 5.59 | 5.3 | 1.1257E7 |  |
 |
1.569E6 | 1.4059E7 | 1.8142E7 | 11.56 | 1 | 518 | 527 | |
| K.FNVEDGEIVQQVR.V | Y | Y | 5.75 | 0.95 | 1.6 | 2.3494E6 |  |
 |
2.2707E6 | 2.686E6 | 2.0914E6 | 1.28 | 1 | 202 | 214 | |
| R.HLLIGLPSGAILSLPK.A | Y | Y | 3.84 | 0.16 | 0.9 | 8.0012E5 |  |
 |
7.881E5 | 8.5002E5 | 7.6224E5 | 1.12 | 1 | 860 | 875 | |
| R.RPEIPTEQSR.E | N | Y | 4.05 | 1.77 | 2.2 | 4.2119E5 |  |
 |
3.3405E5 | 6.6593E5 | 4.3006E5 | 1.99 | 1 | 882 | 891 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NEINIDTLAR.D | Y | Y | 3.93 | 5.59 | 5.3 | 1.1257E7 | |
|
1.569E6 | 1.4059E7 | 1.8142E7 | 11.56 | 1 | 521 | 530 | |
| K.FNVEDGEIVQQVR.V | Y | Y | 5.75 | 0.95 | 1.6 | 2.3494E6 | |
|
2.2707E6 | 2.686E6 | 2.0914E6 | 1.28 | 1 | 202 | 214 | |
| R.HLLIGLPSGAILSLPK.A | Y | Y | 3.84 | 0.16 | 0.9 | 8.0012E5 | |
|
7.881E5 | 8.5002E5 | 7.6224E5 | 1.12 | 1 | 863 | 878 | |
| R.RPEIPTEQSR.E | N | Y | 4.05 | 1.77 | 2.2 | 4.2119E5 | |
|
3.3405E5 | 6.6593E5 | 4.3006E5 | 1.99 | 1 | 885 | 894 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.QTISNAC(+57.02)GTIGLIHAIANNK.D | Y | Y | 5.54 | 2.46 | 0.5 | 3.3362E6 |  |
 |
4.465E6 | 2.5117E6 | 3.0318E6 | 1.78 | 1 | 89 | 108 | Carbamidomethylation |
| K.SQGQDVTSSVYFMK.Q | Y | Y | 7.02 | 2.74 | 6.7 | 2.0919E6 |  |
 |
3.5731E6 | 1.4021E6 | 1.734E6 | 2.55 | 1 | 75 | 88 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ELGGESNFGDALLDAGESMK.R | Y | Y | 7.02 | 4.81 | 1.5 | 1.0385E6 | |
|
3.4987E5 | 1.3415E6 | 1.4241E6 | 4.07 | 1 | 103 | 122 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ELGGESNFGDALLDAGESMK.R | Y | Y | 7.02 | 4.81 | 1.5 | 1.0385E6 | |
|
3.4987E5 | 1.3415E6 | 1.4241E6 | 4.07 | 1 | 103 | 122 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ELGGESNFGDALLDAGESMK.R | Y | Y | 7.02 | 4.81 | 1.5 | 1.0385E6 | |
|
3.4987E5 | 1.3415E6 | 1.4241E6 | 4.07 | 1 | 208 | 227 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ELGGESNFGDALLDAGESMK.R | Y | Y | 7.02 | 4.81 | 1.5 | 1.0385E6 | |
|
3.4987E5 | 1.3415E6 | 1.4241E6 | 4.07 | 1 | 104 | 123 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.KLEELELDEQQR.K | Y | Y | 19.96 | 5.88 | 1.0 | 3.918E5 | |
|
5.8442E5 | 2.1047E5 | 3.805E5 | 2.78 | 1 | 36 | 47 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LASDAGIFFTR.A | Y | Y | 6.92 | 3.11 | 0.6 | 3.4589E5 | |
|
5.0866E5 | 2.1166E5 | 3.1735E5 | 2.40 | 1 | 8 | 18 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VILESEVIAEAVGVK.K | Y | Y | 4.71 | 4.40 | 0.3 | 1.4766E6 | |
|
5.3449E5 | 1.813E6 | 2.0822E6 | 3.90 | 1 | 578 | 592 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.AVSILPLLGHGVPR.L | Y | Y | 6.95 | 2.53 | 0.5 | 9.0913E5 | |
|
5.2449E5 | 1.06E6 | 1.1429E6 | 2.18 | 1 | 179 | 192 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.TC(+57.02)LLISYTTNK.F | Y | Y | 5.53 | 3.08 | 0.5 | 5.4059E6 | |
|
8.1991E6 | 3.7022E6 | 4.3162E6 | 2.21 | 1 | 17 | 27 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NPTIVNFPITNVDLR.E | Y | Y | 3.81 | 1.92 | 1.6 | 1.8175E6 |  |
 |
9.3166E5 | 2.4464E6 | 2.0744E6 | 2.63 | 1 | 466 | 480 | |
| R.AYDGTTYLPGIVGLNNIK.A | Y | Y | 6.66 | 5.84 | 1.0 | 9.0564E5 |  |
 |
3.2548E5 | 1.4216E6 | 9.6984E5 | 4.37 | 1 | 213 | 230 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LYPAVDEQETPLPR.S | Y | Y | 6.40 | 3.37 | 4.4 | 5.4203E5 | |
|
3.0063E5 | 6.4887E5 | 6.7659E5 | 2.25 | 1 | 135 | 148 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LQQTQAQVDEVVDIMR.V | Y | Y | 3.77 | 11.07 | 9.5 | 2.9728E6 |  |
|
8.474E6 | 1.7198E5 | 2.724E5 | 49.27 | 1 | 32 | 47 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LQQTQAQVDEVVDIMR.V | Y | Y | 3.77 | 11.07 | 9.5 | 2.9728E6 | |
|
8.474E6 | 1.7198E5 | 2.724E5 | 49.27 | 1 | 32 | 47 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LQQTQAQVDEVVDIMR.V | Y | Y | 3.77 | 11.07 | 9.5 | 2.9728E6 | |
|
8.474E6 | 1.7198E5 | 2.724E5 | 49.27 | 1 | 32 | 47 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VSFTGSVPTGMK.I | Y | Y | 5.03 | 2.20 | 2.5 | 3.3394E6 |  |
 |
4.6773E6 | 2.2754E6 | 3.0654E6 | 2.06 | 1 | 228 | 239 | |
| M.S(+42.01)TGTFVVSQPLNYR.G | Y | Y | 5.53 | 3.30 | 0.5 | 3.2291E6 |  |
 |
4.3905E6 | 2.0053E6 | 3.2915E6 | 2.19 | 1 | 2 | 15 | Acetylation (N-term) |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VSFTGSVPTGMK.I | Y | Y | 5.03 | 2.20 | 2.5 | 3.3394E6 | |
|
4.6773E6 | 2.2754E6 | 3.0654E6 | 2.06 | 1 | 228 | 239 | |
| M.S(+42.01)TGTFVVSQPLNYR.G | Y | Y | 5.53 | 3.30 | 0.5 | 3.2291E6 | |
|
4.3905E6 | 2.0053E6 | 3.2915E6 | 2.19 | 1 | 2 | 15 | Acetylation (N-term) |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VVSAGTYPVLIQGETSVGK.T | Y | Y | 13.51 | 3.71 | 4.4 | 7.8134E5 | |
|
3.5124E5 | 1.0045E6 | 9.8827E5 | 2.86 | 1 | 1070 | 1088 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.EPFPTIYVDSQK.E | Y | Y | 6.20 | 2.83 | 0.6 | 6.1053E6 |  |
 |
8.8738E6 | 4.6379E6 | 4.8041E6 | 1.91 | 1 | 49 | 60 | |
| R.LEDLVC(+57.02)DVVDR.V | Y | Y | 5.02 | 7.38 | 3.2 | 1.9763E6 |  |
 |
3.6531E6 | 1.4768E6 | 7.99E5 | 4.57 | 1 | 364 | 374 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.EPFPTIYVDSQK.E | Y | Y | 6.20 | 2.83 | 0.6 | 6.1053E6 | |
|
8.8738E6 | 4.6379E6 | 4.8041E6 | 1.91 | 1 | 40 | 51 | |
| R.LEDLVC(+57.02)DVVDR.V | Y | Y | 5.02 | 7.38 | 3.2 | 1.9763E6 | |
|
3.6531E6 | 1.4768E6 | 7.99E5 | 4.57 | 1 | 355 | 365 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SGGELDIVVTSNK.E | Y | Y | 5.16 | 4.35 | 6.8 | 2.9609E6 | |
|
4.503E6 | 1.9263E6 | 2.4533E6 | 2.34 | 1 | 252 | 264 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SLESLDTSLFAK.N | Y | Y | 5.02 | 3.12 | 0.4 | 6.0896E6 |  |
 |
3.5091E6 | 6.8547E6 | 7.9051E6 | 2.25 | 1 | 292 | 303 | |
| R.ENPSEEAQNLVEFTDEEGYGR.Y | Y | Y | 6.63 | 3.20 | 1.0 | 3.2416E6 |  |
 |
1.6273E6 | 4.0715E6 | 4.0261E6 | 2.50 | 1 | 118 | 138 | |
| M(+42.01)ETILEQQR.R | Y | Y | 4.70 | 3.89 | 0.9 | 2.8441E6 |  |
|
1.1044E6 | 3.5962E6 | 3.8318E6 | 3.47 | 1 | 1 | 9 | Acetylation (N-term) |
| R.WQPDTEEEYEDSSGNVVNKK.T | N | Y | 19.47 | 3.78 | 1.1 | 2.4786E6 |  |
 |
1.621E6 | 2.6951E6 | 3.1197E6 | 1.92 | 1 | 471 | 490 | |
| K.LHGLNINYNC(+57.02)EIC(+57.02)GNYTYR.G | N | Y | 6.88 | 8.11 | 2.0 | 1.9913E6 |  |
 |
5.4117E5 | 2.4748E6 | 2.9578E6 | 5.47 | 1 | 399 | 417 | Carbamidomethylation |
| K.SALLALGLK.C | N | Y | 4.90 | 2.38 | 0.6 | 1.2784E6 |  |
 |
7.5994E5 | 1.823E6 | 1.2522E6 | 2.40 | 1 | 265 | 273 | |
| R.WQPDTEEEYEDSSGNVVNK.K | N | Y | 15.55 | 6.02 | 1.4 | 1.1948E6 |  |
 |
5.0219E5 | 1.7758E6 | 1.3065E6 | 3.54 | 1 | 471 | 489 | |
| R.KHPNEIC(+57.02)VPMSVEFEELLK.A | N | Y | 4.11 | 1.04 | 1.0 | 6.4362E4 |  |
 |
1.216E5 | 1.1111E5 | 1.5871E5 | 1.43 | 1 | 97 | 115 | Carbamidomethylation |
| total 8 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.GVEVTVGHEQEEGGK.W | Y | Y | 4.34 | 3.80 | 3.9 | 3.0249E5 | |
|
4.6451E5 | 1.3713E5 | 3.4011E5 | 3.39 | 1 | 187 | 201 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SIC(+57.02)EVLDLER.S | Y | Y | 4.86 | 1.53 | 9.1 | 9.3669E6 |  |
 |
6.8126E6 | 1.0702E7 | 1.0586E7 | 1.57 | 1 | 161 | 170 | Carbamidomethylation |
| K.NVGQFSGFPFEK.G | Y | Y | 4.09 | 3.71 | 3.3 | 8.0274E6 |  |
 |
3.7685E6 | 1.0676E7 | 9.6379E6 | 2.83 | 1 | 128 | 139 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SIC(+57.02)EVLDLER.S | Y | Y | 4.86 | 1.53 | 9.1 | 9.3669E6 | |
|
6.8126E6 | 1.0702E7 | 1.0586E7 | 1.57 | 1 | 161 | 170 | Carbamidomethylation |
| K.NVGQFSGFPFEK.G | Y | Y | 4.09 | 3.71 | 3.3 | 8.0274E6 | |
|
3.7685E6 | 1.0676E7 | 9.6379E6 | 2.83 | 1 | 128 | 139 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.DGLILTSR.G | Y | Y | 5.10 | 9.03 | 3.5 | 1.5907E7 | |
|
3.9907E6 | 2.2886E7 | 2.0844E7 | 5.73 | 1 | 149 | 156 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.WEESGPQFITNSEEVR.L | Y | Y | 7.50 | 5.02 | 0.7 | 1.7323E6 | |
|
6.8699E5 | 2.4411E6 | 2.0689E6 | 3.55 | 1 | 167 | 182 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.GVDILLTSPWPK.Y | Y | Y | 4.75 | 3.12 | 0.5 | 6.959E5 | |
|
1.0081E6 | 5.9474E5 | 4.8486E5 | 2.08 | 1 | 148 | 159 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.WINATDPSAR.T | Y | Y | 3.98 | 3.26 | 3.5 | 4.5138E6 |  |
 |
2.1363E6 | 3.2937E6 | 8.1116E6 | 3.80 | 1 | 541 | 550 | |
| R.ASVGMYLISK.Y | Y | Y | 5.10 | 2.49 | 0.4 | 3.2995E6 |  |
 |
2.8646E6 | 2.2944E6 | 4.7396E6 | 2.07 | 1 | 341 | 350 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VYIYSSGSVEAQK.L | Y | Y | 5.54 | 1.96 | 1.7 | 1.8933E6 |  |
 |
1.5533E6 | 1.909E6 | 2.6948E6 | 1.73 | 1 | 146 | 158 | |
| K.EYLQTHWEEEEC(+57.02)QQDVSLLR.K | Y | Y | 8.89 | 4.06 | 1.0 | 1.5513E6 |  |
|
7.1481E5 | 1.8197E6 | 2.1195E6 | 2.97 | 1 | 41 | 60 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VYIYSSGSVEAQK.L | Y | Y | 5.54 | 1.96 | 1.7 | 1.8933E6 | |
|
1.5533E6 | 1.909E6 | 2.6948E6 | 1.73 | 1 | 159 | 171 | |
| K.EYLQTHWEEEEC(+57.02)QQDVSLLR.K | Y | Y | 8.89 | 4.06 | 1.0 | 1.5513E6 | |
|
7.1481E5 | 1.8197E6 | 2.1195E6 | 2.97 | 1 | 54 | 73 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.YLAALHENC(+57.02)SQLIQTIEDTGTIMR.E | Y | Y | 8.05 | 5.52 | 6.5 | 4.1332E5 | |
|
8.3687E5 | 2.4162E5 | 1.6147E5 | 5.18 | 1 | 559 | 582 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VLC(+57.02)IINPGNPTGQVQSR.K | Y | Y | 7.48 | 6.93 | 1.1 | 7.0506E5 | |
|
1.3953E5 | 8.7525E5 | 1.1004E6 | 7.89 | 1 | 262 | 278 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VLC(+57.02)IINPGNPTGQVQSR.K | Y | Y | 7.48 | 6.93 | 1.1 | 7.0506E5 | |
|
1.3953E5 | 8.7525E5 | 1.1004E6 | 7.89 | 1 | 271 | 287 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VLC(+57.02)IINPGNPTGQVQSR.K | Y | Y | 7.48 | 6.93 | 1.1 | 7.0506E5 | |
|
1.3953E5 | 8.7525E5 | 1.1004E6 | 7.89 | 1 | 284 | 300 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.VVIFQQEQENK.I | Y | Y | 5.42 | 0.58 | 0.5 | 7.8254E6 |  |
 |
7.969E6 | 6.6788E6 | 8.8284E6 | 1.32 | 1 | 52 | 62 | |
| R.YRDPTTVTTLR.V | Y | Y | 4.26 | 7.46 | 1.4 | 5.4373E6 |  |
 |
1.2431E7 | 1.2711E6 | 2.9274E6 | 9.78 | 1 | 143 | 153 | |
| K.GAVDDDVAEADIISTVEFNHSGELLATGDK.G | Y | Y | 8.94 | 2.58 | 0.7 | 4.1817E6 |  |
 |
6.0631E6 | 3.4607E6 | 3.0213E6 | 2.01 | 1 | 19 | 48 | |
| K.NAAQFLLSTNDK.T | N | Y | 4.81 | 2.01 | 3.5 | 3.9425E6 |  |
 |
5.1816E6 | 2.9914E6 | 3.6544E6 | 1.73 | 1 | 106 | 117 | |
| K.LFEEPEDPSNR.S | N | Y | 4.32 | 0.53 | 0.8 | 3.9224E6 |  |
 |
4.2589E6 | 3.164E6 | 4.3441E6 | 1.37 | 1 | 268 | 278 | |
| M.A(+42.01)GAGGGNDIQWC(+57.02)FSQVK.G | N | Y | 5.32 | 1.43 | 0.6 | 1.7291E6 |  |
 |
1.7479E6 | 1.4157E6 | 2.0238E6 | 1.43 | 1 | 2 | 18 | Acetylation (N-term); Carbamidomethylation |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NLTVILSDASAPGEGEHK.I | Y | Y | 4.52 | 6.82 | 3.7 | 2.884E6 |  |
 |
9.2258E5 | 3.4474E6 | 4.5126E6 | 4.89 | 1 | 190 | 207 | |
| K.TGGYLTESGYVNLQR.V | Y | Y | 6.05 | 1.15 | 0.9 | 1.4341E6 |  |
 |
1.2408E6 | 1.3568E6 | 1.7048E6 | 1.37 | 1 | 374 | 388 | |
| R.FDSNC(+57.02)ITPGTEFMDNLAK.C | Y | Y | 10.24 | 1.79 | 1.1 | 1.2934E6 |  |
 |
9.2487E5 | 1.4914E6 | 1.464E6 | 1.61 | 1 | 155 | 172 | Carbamidomethylation |
| K.HDELADSLPC(+57.02)AEGEFIFLR.L | N | Y | 6.61 | 1.77 | 1.2 | 7.5535E5 |  |
 |
5.5743E5 | 9.8999E5 | 7.1864E5 | 1.78 | 1 | 287 | 305 | Carbamidomethylation |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NLTVILSDASAPGEGEHK.I | Y | Y | 4.52 | 6.82 | 3.7 | 2.884E6 | |
|
9.2258E5 | 3.4474E6 | 4.5126E6 | 4.89 | 1 | 190 | 207 | |
| K.TGGYLTESGYVNLQR.V | Y | Y | 6.05 | 1.15 | 0.9 | 1.4341E6 | |
|
1.2408E6 | 1.3568E6 | 1.7048E6 | 1.37 | 1 | 374 | 388 | |
| R.FDSNC(+57.02)ITPGTEFMDNLAK.C | Y | Y | 10.24 | 1.79 | 1.1 | 1.2934E6 | |
|
9.2487E5 | 1.4914E6 | 1.464E6 | 1.61 | 1 | 155 | 172 | Carbamidomethylation |
| K.HDELADSLPC(+57.02)AEGEFIFLR.L | N | Y | 6.61 | 1.77 | 1.2 | 7.5535E5 | |
|
5.5743E5 | 9.8999E5 | 7.1864E5 | 1.78 | 1 | 287 | 305 | Carbamidomethylation |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IC(+57.02)SIALVGK.Y | Y | Y | 4.67 | 2.90 | 0.8 | 8.578E5 | |
|
1.2046E6 | 5.7702E5 | 7.9175E5 | 2.09 | 1 | 298 | 306 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IC(+57.02)SIALVGK.Y | Y | Y | 4.67 | 2.90 | 0.8 | 8.578E5 | |
|
1.2046E6 | 5.7702E5 | 7.9175E5 | 2.09 | 1 | 320 | 328 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.FADNTFSGSYITTIGVDFK.I | Y | Y | 5.91 | 3.90 | 2.5 | 5.3353E5 | |
|
8.9659E5 | 3.8007E5 | 3.2393E5 | 2.77 | 1 | 28 | 46 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ASAELALGENSEVLK.S | Y | Y | 6.77 | 2.27 | 0.3 | 2.8016E7 |  |
 |
4.1486E7 | 2.0518E7 | 2.2045E7 | 2.02 | 1 | 108 | 122 | |
| K.MNLGVGAYR.D | Y | Y | 5.66 | 3.26 | 1.1 | 8.6129E6 |  |
 |
1.3402E7 | 6.414E6 | 6.0228E6 | 2.23 | 1 | 60 | 68 | |
| R.HFIEQGINVC(+57.02)LC(+57.02)QSYAK.N | Y | Y | 5.24 | 4.73 | 1.0 | 8.52E6 |  |
 |
1.4887E7 | 4.178E6 | 6.4954E6 | 3.56 | 2 | 263 | 279 | Carbamidomethylation |
| K.KMNLGVGAYR.D | N | Y | 4.54 | 1.32 | 0.9 | 1.7262E6 |  |
 |
1.7646E6 | 1.5308E6 | 2.2661E6 | 1.48 | 1 | 59 | 68 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ASAELALGENSEVLK.S | Y | Y | 6.77 | 2.27 | 0.3 | 2.8016E7 | |
|
4.1486E7 | 2.0518E7 | 2.2045E7 | 2.02 | 1 | 104 | 118 | |
| K.MNLGVGAYR.D | Y | Y | 5.66 | 3.26 | 1.1 | 8.6129E6 | |
|
1.3402E7 | 6.414E6 | 6.0228E6 | 2.23 | 1 | 60 | 68 | |
| R.HFIEQGINVC(+57.02)LC(+57.02)QSYAK.N | Y | Y | 5.24 | 4.73 | 1.0 | 8.52E6 | |
|
1.4887E7 | 4.178E6 | 6.4954E6 | 3.56 | 2 | 259 | 275 | Carbamidomethylation |
| K.KMNLGVGAYR.D | N | Y | 4.54 | 1.32 | 0.9 | 1.7262E6 | |
|
1.7646E6 | 1.5308E6 | 2.2661E6 | 1.48 | 1 | 59 | 68 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VAQLC(+57.02)DFNPK.S | Y | Y | 6.12 | 4.66 | 2.8 | 9.6945E6 | |
|
1.7893E7 | 5.3655E6 | 5.825E6 | 3.33 | 1 | 195 | 204 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IIDPLPPIDHSEIDYPPFEK.N | Y | Y | 7.51 | 2.64 | 1.0 | 4.0893E6 |  |
 |
6.5149E6 | 3.1347E6 | 2.6182E6 | 2.49 | 1 | 250 | 269 | |
| R.VVQGDIGEANEDVTQIVEILHSGPSK.W | Y | Y | 5.28 | 8.11 | 3.0 | 2.8664E6 |  |
 |
4.4253E6 | 3.0522E6 | 1.1217E6 | 3.95 | 1 | 513 | 538 | |
| K.NFYNEHEEITNLTPQQLIDLR.H | Y | Y | 5.05 | 0.38 | 0.9 | 2.2768E6 |  |
 |
2.1345E6 | 2.2861E6 | 2.4098E6 | 1.13 | 1 | 270 | 290 | |
| K.DIPVLVATDVAAR.G | N | Y | 5.74 | 1.50 | 0.4 | 1.784E6 |  |
 |
2.4801E6 | 1.7495E6 | 1.7423E6 | 1.42 | 1 | 602 | 614 | |
| K.ELEPGDGPIAVIVC(+57.02)PTR.E | N | Y | 4.91 | 1.54 | 5.9 | 1.6619E6 |  |
 |
1.1199E6 | 1.8254E6 | 2.0405E6 | 1.82 | 1 | 374 | 390 | Carbamidomethylation |
| R.KSEYTQPTPIQC(+57.02)QGVPVALSGR.D | N | Y | 42.35 | 1.92 | 0.7 | 1.239E6 |  |
 |
1.6034E6 | 1.0141E6 | 1.0996E6 | 1.58 | 1 | 324 | 345 | Carbamidomethylation |
| R.SVAVYGGGSMWEQAK.A | N | Y | 13.74 | 1.29 | 2.5 | 5.6965E5 |  |
 |
6.1474E5 | 4.4515E5 | 6.4905E5 | 1.46 | 1 | 411 | 425 | |
| K.GIRDDIEEEDDQEAYFR.Y | N | Y | 16.80 | 2.36 | 1.8 | 1.8836E5 |  |
|
2.4405E5 | 1.5364E5 | 1.674E5 | 1.59 | 1 | 200 | 216 | |
| K.SEYTQPTPIQC(+57.02)QGVPVALSGR.D | N | Y | 4.23 | 2.39 | 0.9 | 3.2405E4 |  |
 |
9.3158E4 | 4.3839E4 | 1.1486E5 | 2.62 | 1 | 325 | 345 | Carbamidomethylation |
| total 9 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IIDPLPPIDHSEIDYPPFEK.N | Y | Y | 7.51 | 2.64 | 1.0 | 4.0893E6 | |
|
6.5149E6 | 3.1347E6 | 2.6182E6 | 2.49 | 1 | 196 | 215 | |
| R.VVQGDIGEANEDVTQIVEILHSGPSK.W | Y | Y | 5.28 | 8.11 | 3.0 | 2.8664E6 | |
|
4.4253E6 | 3.0522E6 | 1.1217E6 | 3.95 | 1 | 459 | 484 | |
| K.NFYNEHEEITNLTPQQLIDLR.H | Y | Y | 5.05 | 0.38 | 0.9 | 2.2768E6 | |
|
2.1345E6 | 2.2861E6 | 2.4098E6 | 1.13 | 1 | 216 | 236 | |
| K.DIPVLVATDVAAR.G | N | Y | 5.74 | 1.50 | 0.4 | 1.784E6 | |
|
2.4801E6 | 1.7495E6 | 1.7423E6 | 1.42 | 1 | 548 | 560 | |
| K.ELEPGDGPIAVIVC(+57.02)PTR.E | N | Y | 4.91 | 1.54 | 5.9 | 1.6619E6 | |
|
1.1199E6 | 1.8254E6 | 2.0405E6 | 1.82 | 1 | 320 | 336 | Carbamidomethylation |
| R.KSEYTQPTPIQC(+57.02)QGVPVALSGR.D | N | Y | 42.35 | 1.92 | 0.7 | 1.239E6 | |
|
1.6034E6 | 1.0141E6 | 1.0996E6 | 1.58 | 1 | 270 | 291 | Carbamidomethylation |
| R.SVAVYGGGSMWEQAK.A | N | Y | 13.74 | 1.29 | 2.5 | 5.6965E5 | |
|
6.1474E5 | 4.4515E5 | 6.4905E5 | 1.46 | 1 | 357 | 371 | |
| K.GIRDDIEEEDDQEAYFR.Y | N | Y | 16.80 | 2.36 | 1.8 | 1.8836E5 | |
|
2.4405E5 | 1.5364E5 | 1.674E5 | 1.59 | 1 | 146 | 162 | |
| K.SEYTQPTPIQC(+57.02)QGVPVALSGR.D | N | Y | 4.23 | 2.39 | 0.9 | 3.2405E4 | |
|
9.3158E4 | 4.3839E4 | 1.1486E5 | 2.62 | 1 | 271 | 291 | Carbamidomethylation |
| total 9 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.QHSVVPSQIFELEDGTSSYK.D | Y | Y | 18.80 | 6.50 | 0.6 | 1.1355E6 |  |
 |
2.075E6 | 6.7206E5 | 6.5945E5 | 3.15 | 1 | 458 | 477 | |
| K.TIPGTALVEMGDEYAVER.A | Y | Y | 5.12 | 5.53 | 0.5 | 9.9636E5 |  |
 |
2.1452E6 | 5.5641E5 | 5.6879E5 | 3.86 | 1 | 419 | 436 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.GITNLC(+57.02)VIGGDGSLTGADTFR.S | Y | Y | 7.14 | 3.09 | 1.1 | 2.1551E6 |  |
 |
3.4812E6 | 1.52E6 | 1.4641E6 | 2.38 | 1 | 180 | 200 | Carbamidomethylation |
| K.AIAVLTSGGDAQGMNAAVR.A | Y | Y | 12.53 | 2.87 | 0.9 | 1.5617E6 |  |
 |
2.2996E6 | 9.2048E5 | 1.4649E6 | 2.50 | 1 | 88 | 106 | |
| K.GQIEEAGWSYVGGWTGQGGSK.L | Y | Y | 10.39 | 2.00 | 0.7 | 1.324E6 |  |
 |
1.7901E6 | 9.2957E5 | 1.2524E6 | 1.93 | 1 | 517 | 537 | |
| R.IFANTPDSGC(+57.02)VLGMR.K | N | Y | 4.90 | 3.64 | 9.8 | 4.7247E5 |  |
 |
1.0009E6 | 2.794E5 | 6.3755E5 | 3.58 | 1 | 771 | 785 | Carbamidomethylation |
| K.RGITNLC(+57.02)VIGGDGSLTGADTFR.S | N | Y | 12.77 | 2.58 | 5.6 | 4.4413E5 |  |
 |
6.1517E5 | 2.7841E5 | 4.3881E5 | 2.21 | 1 | 179 | 200 | Carbamidomethylation |
| R.LNIIIVAEGAIDK.N | N | Y | 6.49 | 5.99 | 0.9 | 2.9762E5 |  |
 |
5.609E5 | 1.9728E5 | 1.3467E5 | 4.16 | 1 | 328 | 340 | |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.GITNLC(+57.02)VIGGDGSLTGADTFR.S | Y | Y | 7.14 | 3.09 | 1.1 | 2.1551E6 | |
|
3.4812E6 | 1.52E6 | 1.4641E6 | 2.38 | 1 | 109 | 129 | Carbamidomethylation |
| K.AIAVLTSGGDAQGMNAAVR.A | Y | Y | 12.53 | 2.87 | 0.9 | 1.5617E6 | |
|
2.2996E6 | 9.2048E5 | 1.4649E6 | 2.50 | 1 | 17 | 35 | |
| K.GQIEEAGWSYVGGWTGQGGSK.L | Y | Y | 10.39 | 2.00 | 0.7 | 1.324E6 | |
|
1.7901E6 | 9.2957E5 | 1.2524E6 | 1.93 | 1 | 446 | 466 | |
| R.IFANTPDSGC(+57.02)VLGMR.K | N | Y | 4.90 | 3.64 | 9.8 | 4.7247E5 | |
|
1.0009E6 | 2.794E5 | 6.3755E5 | 3.58 | 1 | 700 | 714 | Carbamidomethylation |
| K.RGITNLC(+57.02)VIGGDGSLTGADTFR.S | N | Y | 12.77 | 2.58 | 5.6 | 4.4413E5 | |
|
6.1517E5 | 2.7841E5 | 4.3881E5 | 2.21 | 1 | 108 | 129 | Carbamidomethylation |
| R.LNIIIVAEGAIDK.N | N | Y | 6.49 | 5.99 | 0.9 | 2.9762E5 | |
|
5.609E5 | 1.9728E5 | 1.3467E5 | 4.16 | 1 | 257 | 269 | |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.C(+57.02)QAAEPQIITGSHDTTIR.L | Y | Y | 12.00 | 2.39 | 0.5 | 1.3601E6 | |
|
7.735E5 | 1.6393E6 | 1.6674E6 | 2.16 | 1 | 338 | 355 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LGTDESC(+57.02)FNMILATR.S | Y | Y | 4.90 | 4.03 | 1.1 | 2.4063E6 |  |
 |
4.7698E6 | 1.1982E6 | 1.2509E6 | 3.98 | 1 | 332 | 346 | Carbamidomethylation |
| R.DLLSSVSR.E | Y | Y | 3.50 | 1.77 | 9.8 | 2.0309E6 |  |
 |
2.218E6 | 1.1336E6 | 2.7411E6 | 2.42 | 1 | 365 | 372 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SSGASVTTQPTEFK.I | Y | Y | 5.74 | 3.86 | 1.0 | 1.286E6 | |
|
8.2125E5 | 1.9237E6 | 1.5938E6 | 2.34 | 1 | 385 | 398 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.AEEDVEPEC(+57.02)IMEK.V | Y | Y | 8.08 | 2.85 | 6.7 | 1.4261E6 | |
|
2.1447E6 | 8.8665E5 | 1.2469E6 | 2.42 | 1 | 119 | 131 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.HQIVEVAGDDK.Y | Y | Y | 3.58 | 3.40 | 1.1 | 7.727E5 | |
|
1.7655E6 | 3.115E5 | 4.2535E5 | 5.67 | 1 | 70 | 80 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.HQIVEVAGDDK.Y | Y | Y | 3.58 | 3.40 | 1.1 | 7.727E5 | |
|
1.7655E6 | 3.115E5 | 4.2535E5 | 5.67 | 1 | 70 | 80 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.HQIVEVAGDDK.Y | Y | Y | 3.58 | 3.40 | 1.1 | 7.727E5 | |
|
1.7655E6 | 3.115E5 | 4.2535E5 | 5.67 | 1 | 143 | 153 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| M.A(+42.01)VPETRPNHTIYINNLNEK.I | Y | Y | 10.72 | 2.51 | 0.5 | 7.8869E6 |  |
 |
4.4164E6 | 9.6323E6 | 9.6119E6 | 2.18 | 1 | 2 | 20 | Acetylation (N-term) |
| R.HDIAFVEFDNEVQAGAAR.D | Y | Y | 7.34 | 2.45 | 2.2 | 7.3068E6 |  |
 |
3.9488E6 | 1.0127E7 | 7.8443E6 | 2.56 | 2 | 243 | 260 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.NFINNPLAQADWAAK.K | Y | Y | 6.93 | 3.29 | 0.4 | 7.4653E6 |  |
 |
1.1112E7 | 4.5718E6 | 6.7119E6 | 2.43 | 1 | 15 | 29 | |
| R.IAQLEEELEEEQGNTELINDR.L | Y | Y | 6.34 | 2.75 | 0.7 | 7.1589E6 |  |
 |
1.1078E7 | 4.4136E6 | 5.9854E6 | 2.51 | 2 | 1733 | 1753 | |
| K.LQLQEQLQAETELC(+57.02)AEAEELR.A | Y | Y | 4.59 | 2.30 | 0.9 | 1.9191E6 |  |
 |
2.975E6 | 1.3676E6 | 1.4147E6 | 2.18 | 1 | 885 | 905 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IGTYTGPLQHGIVYSGGSSDTIC(+57.02)DLLGAK.G | Y | Y | 11.22 | 6.97 | 0.9 | 2.3724E6 | |
|
5.2568E6 | 9.3707E5 | 9.2339E5 | 5.69 | 1 | 340 | 368 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IGTYTGPLQHGIVYSGGSSDTIC(+57.02)DLLGAK.G | Y | Y | 11.22 | 6.97 | 0.9 | 2.3724E6 | |
|
5.2568E6 | 9.3707E5 | 9.2339E5 | 5.69 | 1 | 339 | 367 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IGTYTGPLQHGIVYSGGSSDTIC(+57.02)DLLGAK.G | Y | Y | 11.22 | 6.97 | 0.9 | 2.3724E6 | |
|
5.2568E6 | 9.3707E5 | 9.2339E5 | 5.69 | 1 | 314 | 342 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IGTYTGPLQHGIVYSGGSSDTIC(+57.02)DLLGAK.G | Y | Y | 11.22 | 6.97 | 0.9 | 2.3724E6 | |
|
5.2568E6 | 9.3707E5 | 9.2339E5 | 5.69 | 1 | 339 | 367 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IVC(+57.02)TPGQGLGDLR.T | Y | Y | 5.88 | 1.97 | 3.2 | 2.2266E6 | |
|
3.0583E6 | 1.5082E6 | 2.1133E6 | 2.03 | 1 | 310 | 322 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.AIILAAAPGEK.L | Y | Y | 3.81 | 0.90 | 0.6 | 2.0579E6 |  |
 |
2.7501E6 | 1.7235E6 | 1.7E6 | 1.62 | 1 | 1317 | 1327 | |
| R.MGYQC(+57.02)TFGVLQAGQYGVAQTR.R | Y | Y | 6.27 | 40.81 | 3.5 | 1.9908E6 |  |
 |
5.7413E6 | 8.7598E4 | 1.9133E5 | 64.00 | 1 | 1294 | 1314 | Carbamidomethylation |
| K.LPLFPEPLHVFAPR.A | Y | Y | 5.61 | 2.25 | 0.8 | 1.8919E6 |  |
 |
2.4787E6 | 1.6651E6 | 1.5318E6 | 1.62 | 1 | 1328 | 1341 | |
| K.GSNLDAPEPYR.I | N | Y | 4.42 | 2.29 | 6.0 | 1.1371E6 |  |
 |
9.7267E5 | 2.1055E6 | 8.5945E5 | 2.45 | 1 | 986 | 996 | |
| K.LNLLHEFLQTEIK.S | N | Y | 6.05 | 2.55 | 1.0 | 5.0615E5 |  |
 |
6.2594E5 | 5.5589E5 | 3.3664E5 | 1.86 | 1 | 46 | 58 | |
| total 5 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.TFAVDETSVSGYIYHK.L | Y | Y | 3.84 | 4.93 | 10.8 | 4.2769E6 |  |
 |
9.204E5 | 3.0365E6 | 9.104E6 | 9.89 | 1 | 435 | 450 | |
| R.YGVIIVGNPK.A | Y | Y | 6.47 | 0.44 | 0.5 | 2.2348E6 |  |
 |
2.101E6 | 2.1331E6 | 2.4703E6 | 1.18 | 1 | 874 | 883 | |
| K.AGLSQSLFER.L | Y | Y | 7.78 | 0.62 | 2.3 | 2.2334E6 |  |
 |
1.9068E6 | 2.3577E6 | 2.4359E6 | 1.28 | 1 | 684 | 693 | |
| K.VPDNYGDEIAIELR.S | N | Y | 5.92 | 0.49 | 0.8 | 2.1322E6 |  |
 |
1.9312E6 | 2.3844E6 | 2.0809E6 | 1.23 | 1 | 389 | 402 | |
| R.ANEHQGIGFLNDPR.R | N | Y | 7.19 | 1.10 | 0.9 | 2.0257E6 |  |
 |
1.5749E6 | 2.1816E6 | 2.3206E6 | 1.47 | 1 | 850 | 863 | |
| K.ENPSATLEDLEKPGVDEEPQHVLLR.Y | N | Y | 15.18 | 1.11 | 0.8 | 1.9252E6 |  |
 |
1.7279E6 | 2.3332E6 | 1.7144E6 | 1.36 | 1 | 266 | 290 | |
| R.EAIDSPVSFLALHNQIR.N | N | Y | 5.70 | 10.13 | 3.2 | 1.81E6 |  |
 |
4.0922E5 | 2.2565E6 | 2.7644E6 | 6.76 | 1 | 556 | 572 | |
| R.YEDAYQYQNIFGPLVK.L | N | Y | 4.51 | 1.37 | 2.6 | 1.5561E6 |  |
 |
1.8759E6 | 1.1082E6 | 1.6842E6 | 1.69 | 1 | 291 | 306 | |
| K.TVLQRPLSLIQGPPGTGK.T | N | Y | 25.87 | 1.02 | 0.9 | 1.3669E6 |  |
 |
1.5773E6 | 1.1932E6 | 1.3303E6 | 1.32 | 1 | 487 | 504 | |
| K.SQIDVALSQDSTYQGER.A | N | Y | 13.35 | 0.85 | 1.0 | 1.3042E6 |  |
 |
1.0834E6 | 1.3715E6 | 1.4577E6 | 1.35 | 1 | 1095 | 1111 | |
| K.ADSVVVLLC(+57.02)R.Q | N | Y | 4.21 | 1.73 | 4.6 | 1.0989E6 |  |
 |
7.4129E5 | 1.0745E6 | 1.4809E6 | 2.00 | 1 | 196 | 205 | Carbamidomethylation |
| K.LYQEVEIASVDAFQGR.E | N | Y | 6.90 | 1.64 | 2.8 | 1.0645E6 |  |
 |
7.8528E5 | 1.1724E6 | 1.2359E6 | 1.57 | 1 | 823 | 838 | |
| K.DGPLGETVLEC(+57.02)YNC(+57.02)GC(+57.02)R.N | N | Y | 6.37 | 7.50 | 1.0 | 9.511E5 |  |
 |
2.5773E5 | 1.2111E6 | 1.3845E6 | 5.37 | 1 | 168 | 184 | Carbamidomethylation |
| R.SILIDESTQATEPEC(+57.02)MVPVVLGAK.Q | N | Y | 9.61 | 0.92 | 1.3 | 1.4126E6 |  |
 |
1.119E6 | 1.5055E6 | 1.6131E6 | 1.44 | 2 | 638 | 661 | Carbamidomethylation |
| K.TSQLLAELNFEEDEEDTYYTK.D | N | Y | 5.57 | 0.97 | 1.2 | 6.7262E5 |  |
 |
6.7408E5 | 8.6135E5 | 6.5094E5 | 1.32 | 1 | 91 | 111 | |
| R.C(+57.02)FLSWLVK.I | N | Y | 4.10 | 2.85 | 0.7 | 2.4826E5 |  |
 |
1.2904E5 | 2.9544E5 | 3.203E5 | 2.48 | 1 | 232 | 239 | Carbamidomethylation |
| K.DETGELSSADEKR.Y | N | Y | 5.13 | 1.34 | 1.4 | 2.2645E5 |  |
 |
1.8145E5 | 2.7653E5 | 2.9051E5 | 1.60 | 1 | 588 | 600 | |
| total 17 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LYVYNTDTDNC(+57.02)R.E | Y | Y | 7.16 | 2.83 | 1.0 | 1.7049E6 | |
|
2.8244E6 | 1.2026E6 | 1.3884E6 | 2.35 | 1 | 163 | 174 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LYVYNTDTDNC(+57.02)R.E | Y | Y | 7.16 | 2.83 | 1.0 | 1.7049E6 | |
|
2.8244E6 | 1.2026E6 | 1.3884E6 | 2.35 | 1 | 143 | 154 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LYVYNTDTDNC(+57.02)R.E | Y | Y | 7.16 | 2.83 | 1.0 | 1.7049E6 | |
|
2.8244E6 | 1.2026E6 | 1.3884E6 | 2.35 | 1 | 159 | 170 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LYVYNTDTDNC(+57.02)R.E | Y | Y | 7.16 | 2.83 | 1.0 | 1.7049E6 | |
|
2.8244E6 | 1.2026E6 | 1.3884E6 | 2.35 | 1 | 163 | 174 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LLFEGAGSNPGDK.T | Y | Y | 4.01 | 1.85 | 2.1 | 5.9021E6 |  |
|
9.0185E6 | 4.7981E6 | 3.8898E6 | 2.32 | 1 | 312 | 324 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.LLFEGAGSNPGDK.T | Y | Y | 4.01 | 1.85 | 2.1 | 5.9021E6 | |
|
9.0185E6 | 4.7981E6 | 3.8898E6 | 2.32 | 1 | 338 | 350 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VFVGGLSPDTSEEQIK.E | Y | Y | 5.46 | 4.79 | 0.6 | 2.2105E7 |  |
 |
9.4638E6 | 3.2056E7 | 2.4796E7 | 3.39 | 1 | 235 | 250 | |
| K.MFIGGLSWDTSK.K | Y | Y | 3.86 | 2.25 | 4.3 | 3.6628E6 |  |
 |
1.7766E6 | 6.1935E6 | 3.0182E6 | 3.49 | 1 | 150 | 161 | |
| R.GFC(+57.02)FITYTDEEPVKK.L | Y | Y | 6.88 | 2.13 | 1.8 | 1.8075E6 |  |
 |
2.3994E6 | 1.7138E6 | 1.3095E6 | 1.83 | 1 | 275 | 289 | Carbamidomethylation |
| R.GFC(+57.02)FITYTDEEPVK.K | N | Y | 6.43 | 7.73 | 1.1 | 9.2529E5 |  |
 |
3.2674E5 | 1.4492E6 | 1.0816E6 | 4.44 | 1 | 275 | 288 | Carbamidomethylation |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VFVGGLSPDTSEEQIK.E | Y | Y | 5.46 | 4.79 | 0.6 | 2.2105E7 | |
|
9.4638E6 | 3.2056E7 | 2.4796E7 | 3.39 | 1 | 235 | 250 | |
| K.MFIGGLSWDTSK.K | Y | Y | 3.86 | 2.25 | 4.3 | 3.6628E6 | |
|
1.7766E6 | 6.1935E6 | 3.0182E6 | 3.49 | 1 | 150 | 161 | |
| R.GFC(+57.02)FITYTDEEPVKK.L | Y | Y | 6.88 | 2.13 | 1.8 | 1.8075E6 | |
|
2.3994E6 | 1.7138E6 | 1.3095E6 | 1.83 | 1 | 275 | 289 | Carbamidomethylation |
| R.GFC(+57.02)FITYTDEEPVK.K | N | Y | 6.43 | 7.73 | 1.1 | 9.2529E5 | |
|
3.2674E5 | 1.4492E6 | 1.0816E6 | 4.44 | 1 | 275 | 288 | Carbamidomethylation |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SSLGSHQLPR.G | Y | Y | 4.32 | 2.57 | 2.1 | 1.4281E6 | |
|
2.8372E6 | 8.175E5 | 8.3399E5 | 3.47 | 1 | 197 | 206 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SAIDLEEMASGLNK.R | Y | Y | 4.97 | 3.46 | 6.3 | 3.3862E6 |  |
 |
1.7783E6 | 4.3313E6 | 4.049E6 | 2.44 | 1 | 58 | 71 | |
| K.GGGALSAVAATK.S | Y | Y | 3.78 | 0.45 | 6.3 | 2.2084E6 |  |
 |
2.0933E6 | 2.3769E6 | 2.7492E6 | 1.31 | 1 | 256 | 267 | |
| R.DVQELLTQYTK.F | Y | Y | 4.48 | 4.22 | 0.5 | 1.6463E6 |  |
 |
5.9896E5 | 1.9194E6 | 2.4205E6 | 4.04 | 1 | 416 | 426 | |
| K.LLGMGDIEGLIDK.V | N | Y | 4.31 | 1.23 | 0.4 | 1.2879E6 |  |
 |
8.6983E5 | 1.712E6 | 1.282E6 | 1.97 | 1 | 294 | 306 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IAQSDYIPTQQDVLR.T | Y | Y | 6.63 | 7.98 | 0.5 | 2.4046E6 |  |
 |
5.3158E6 | 1.0387E6 | 8.5929E5 | 6.19 | 1 | 163 | 177 | |
| K.YDEAASYIQSK.F | Y | Y | 5.20 | 5.57 | 0.7 | 9.9721E5 |  |
 |
2.076E6 | 7.3155E5 | 4.8932E5 | 4.24 | 1 | 297 | 307 | |
| K.IIHEDGYSEEEC(+57.02)R.Q | Y | Y | 6.88 | 14.09 | 1.4 | 7.991E4 |  |
 |
2.1373E5 | 3.3776E4 | 1.8227E4 | 11.73 | 1 | 55 | 67 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SESLIDASEDSQLEAAIR.A | Y | Y | 20.21 | 4.41 | 1.2 | 3.9334E5 | |
|
6.1523E5 | 2.7227E5 | 2.925E5 | 2.26 | 1 | 279 | 296 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LDYLGVSYGLTPR.L | Y | Y | 4.78 | 1.22 | 3.3 | 2.9839E6 |  |
 |
2.6548E6 | 3.7144E6 | 2.5824E6 | 1.44 | 1 | 706 | 718 | |
| R.KDLPPLLLK.L | Y | Y | 5.15 | 8.31 | 0.7 | 2.5688E6 |  |
 |
8.7974E5 | 3.7047E6 | 3.1219E6 | 4.21 | 1 | 689 | 697 | |
| R.IVSGC(+57.02)PLPEAC(+57.02)ELYYVNR.D | Y | Y | 6.88 | 4.20 | 1.6 | 2.5581E6 |  |
|
1.1811E6 | 3.5122E6 | 2.9811E6 | 2.97 | 1 | 495 | 512 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LDYLGVSYGLTPR.L | Y | Y | 4.78 | 1.22 | 3.3 | 2.9839E6 | |
|
2.6548E6 | 3.7144E6 | 2.5824E6 | 1.44 | 1 | 672 | 684 | |
| R.KDLPPLLLK.L | Y | Y | 5.15 | 8.31 | 0.7 | 2.5688E6 | |
|
8.7974E5 | 3.7047E6 | 3.1219E6 | 4.21 | 1 | 655 | 663 | |
| R.IVSGC(+57.02)PLPEAC(+57.02)ELYYVNR.D | Y | Y | 6.88 | 4.20 | 1.6 | 2.5581E6 | |
|
1.1811E6 | 3.5122E6 | 2.9811E6 | 2.97 | 1 | 461 | 478 | Carbamidomethylation |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.HSFGPLDYESLQQELALK.D | Y | Y | 5.21 | 2.69 | 3.4 | 2.4161E6 | |
|
1.2949E6 | 3.0455E6 | 2.9078E6 | 2.35 | 1 | 555 | 572 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IQIEAIPLALQGR.D | Y | Y | 4.35 | 5.81 | 0.4 | 1.9571E6 | |
|
5.7951E5 | 2.9714E6 | 2.3203E6 | 5.13 | 1 | 50 | 62 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IQIEAIPLALQGR.D | Y | Y | 4.35 | 5.81 | 0.4 | 1.9571E6 | |
|
5.7951E5 | 2.9714E6 | 2.3203E6 | 5.13 | 1 | 50 | 62 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IQIEAIPLALQGR.D | Y | Y | 4.35 | 5.81 | 0.4 | 1.9571E6 | |
|
5.7951E5 | 2.9714E6 | 2.3203E6 | 5.13 | 1 | 50 | 62 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.DFLLQQTMLR.I | Y | Y | 4.38 | 3.01 | 7.3 | 1.0026E7 | |
|
4.988E6 | 1.1612E7 | 1.348E7 | 2.70 | 1 | 29 | 38 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VTQDATPGSALDK.I | Y | Y | 3.31 | 1.29 | 1.0 | 4.1687E6 |  |
 |
5.8989E6 | 2.6259E6 | 5.2943E6 | 2.25 | 1 | 388 | 400 | |
| K.NSIYSGLEAFGDVK.L | Y | Y | 6.22 | 2.10 | 1.1 | 1.3684E6 |  |
 |
1.619E6 | 8.5529E5 | 1.631E6 | 1.91 | 1 | 292 | 305 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VTQDATPGSALDK.I | Y | Y | 3.31 | 1.29 | 1.0 | 4.1687E6 | |
|
5.8989E6 | 2.6259E6 | 5.2943E6 | 2.25 | 1 | 388 | 400 | |
| K.NSIYSGLEAFGDVK.L | Y | Y | 6.22 | 2.10 | 1.1 | 1.3684E6 | |
|
1.619E6 | 8.5529E5 | 1.631E6 | 1.91 | 1 | 292 | 305 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.FGLFTPGSR.I | Y | Y | 4.40 | 2.53 | 0.9 | 2.3374E6 |  |
 |
1.2525E6 | 3.308E6 | 2.4517E6 | 2.64 | 1 | 394 | 402 | |
| R.IESILMSLPLTAR.W | Y | Y | 3.81 | 2.79 | 0.6 | 1.0565E6 |  |
 |
6.5668E5 | 2.5187E6 | 1.2479E6 | 3.84 | 1 | 403 | 415 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VPAELIC(+57.02)LDPR.A | Y | Y | 3.36 | 3.76 | 7.7 | 1.2598E6 | |
|
2.954E5 | 1.9923E6 | 1.4917E6 | 6.74 | 1 | 538 | 548 | Carbamidomethylation |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IAFGGETDEATR.Y | Y | Y | 4.24 | 1.93 | 2.8 | 3.5749E6 |  |
 |
6.1596E6 | 2.5364E6 | 2.7047E6 | 2.43 | 1 | 377 | 388 | |
| K.HLTPVTLELGGK.S | Y | Y | 4.81 | 2.80 | 3.9 | 2.201E6 |  |
 |
3.3008E6 | 1.4491E6 | 1.8531E6 | 2.28 | 1 | 277 | 288 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IAFGGETDEATR.Y | Y | Y | 4.24 | 1.93 | 2.8 | 3.5749E6 | |
|
6.1596E6 | 2.5364E6 | 2.7047E6 | 2.43 | 1 | 377 | 388 | |
| K.HLTPVTLELGGK.S | Y | Y | 4.81 | 2.80 | 3.9 | 2.201E6 | |
|
3.3008E6 | 1.4491E6 | 1.8531E6 | 2.28 | 1 | 277 | 288 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IAFGGETDEATR.Y | Y | Y | 4.24 | 1.93 | 2.8 | 3.5749E6 | |
|
6.1596E6 | 2.5364E6 | 2.7047E6 | 2.43 | 1 | 300 | 311 | |
| K.HLTPVTLELGGK.S | Y | Y | 4.81 | 2.80 | 3.9 | 2.201E6 | |
|
3.3008E6 | 1.4491E6 | 1.8531E6 | 2.28 | 1 | 200 | 211 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IAFGGETDEATR.Y | Y | Y | 4.24 | 1.93 | 2.8 | 3.5749E6 | |
|
6.1596E6 | 2.5364E6 | 2.7047E6 | 2.43 | 1 | 300 | 311 | |
| K.HLTPVTLELGGK.S | Y | Y | 4.81 | 2.80 | 3.9 | 2.201E6 | |
|
3.3008E6 | 1.4491E6 | 1.8531E6 | 2.28 | 1 | 200 | 211 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.IAFGGETDEATR.Y | Y | Y | 4.24 | 1.93 | 2.8 | 3.5749E6 | |
|
6.1596E6 | 2.5364E6 | 2.7047E6 | 2.43 | 1 | 300 | 311 | |
| K.HLTPVTLELGGK.S | Y | Y | 4.81 | 2.80 | 3.9 | 2.201E6 | |
|
3.3008E6 | 1.4491E6 | 1.8531E6 | 2.28 | 1 | 200 | 211 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NPAVLSAASFDGR.I | Y | Y | 8.36 | 1.27 | 1.5 | 1.7069E6 |  |
 |
2.261E6 | 1.364E6 | 1.4957E6 | 1.66 | 1 | 315 | 327 | |
| K.TQPPEDISC(+57.02)IAWNR.Q | Y | Y | 6.27 | 7.50 | 0.8 | 1.4042E6 |  |
 |
2.3162E6 | 6.6856E5 | 1.2278E6 | 3.46 | 1 | 165 | 178 | Carbamidomethylation |
| K.NVWSFLK.V | Y | Y | 5.52 | 1.50 | 0.5 | 3.5225E5 |  |
 |
3.8095E5 | 2.5435E5 | 4.2145E5 | 1.66 | 1 | 471 | 477 | |
| R.QVQHILASASPSGR.A | N | Y | 4.56 | 2.64 | 6.5 | 7.4665E4 |  |
 |
1.3646E5 | 5.3974E4 | 1.2109E5 | 2.53 | 1 | 179 | 192 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NPAVLSAASFDGR.I | Y | Y | 8.36 | 1.27 | 1.5 | 1.7069E6 | |
|
2.261E6 | 1.364E6 | 1.4957E6 | 1.66 | 1 | 315 | 327 | |
| K.TQPPEDISC(+57.02)IAWNR.Q | Y | Y | 6.27 | 7.50 | 0.8 | 1.4042E6 | |
|
2.3162E6 | 6.6856E5 | 1.2278E6 | 3.46 | 1 | 165 | 178 | Carbamidomethylation |
| K.NVWSFLK.V | Y | Y | 5.52 | 1.50 | 0.5 | 3.5225E5 | |
|
3.8095E5 | 2.5435E5 | 4.2145E5 | 1.66 | 1 | 471 | 477 | |
| R.QVQHILASASPSGR.A | N | Y | 4.56 | 2.64 | 6.5 | 7.4665E4 | |
|
1.3646E5 | 5.3974E4 | 1.2109E5 | 2.53 | 1 | 179 | 192 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NPAVLSAASFDGR.I | Y | Y | 8.36 | 1.27 | 1.5 | 1.7069E6 | |
|
2.261E6 | 1.364E6 | 1.4957E6 | 1.66 | 1 | 315 | 327 | |
| K.TQPPEDISC(+57.02)IAWNR.Q | Y | Y | 6.27 | 7.50 | 0.8 | 1.4042E6 | |
|
2.3162E6 | 6.6856E5 | 1.2278E6 | 3.46 | 1 | 165 | 178 | Carbamidomethylation |
| K.NVWSFLK.V | Y | Y | 5.52 | 1.50 | 0.5 | 3.5225E5 | |
|
3.8095E5 | 2.5435E5 | 4.2145E5 | 1.66 | 1 | 471 | 477 | |
| R.QVQHILASASPSGR.A | N | Y | 4.56 | 2.64 | 6.5 | 7.4665E4 | |
|
1.3646E5 | 5.3974E4 | 1.2109E5 | 2.53 | 1 | 179 | 192 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.NPAVLSAASFDGR.I | Y | Y | 8.36 | 1.27 | 1.5 | 1.7069E6 | |
|
2.261E6 | 1.364E6 | 1.4957E6 | 1.66 | 1 | 315 | 327 | |
| K.TQPPEDISC(+57.02)IAWNR.Q | Y | Y | 6.27 | 7.50 | 0.8 | 1.4042E6 | |
|
2.3162E6 | 6.6856E5 | 1.2278E6 | 3.46 | 1 | 165 | 178 | Carbamidomethylation |
| K.NVWSFLK.V | Y | Y | 5.52 | 1.50 | 0.5 | 3.5225E5 | |
|
3.8095E5 | 2.5435E5 | 4.2145E5 | 1.66 | 1 | 471 | 477 | |
| R.QVQHILASASPSGR.A | N | Y | 4.56 | 2.64 | 6.5 | 7.4665E4 | |
|
1.3646E5 | 5.3974E4 | 1.2109E5 | 2.53 | 1 | 179 | 192 | |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SDEVTQEISDETR.V | Y | Y | 5.68 | 12.80 | 1.4 | 1.4447E5 |  |
|
3.4429E5 | 4.0432E4 | 7.8406E4 | 8.52 | 1 | 782 | 794 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SDEVTQEISDETR.V | Y | Y | 5.68 | 12.80 | 1.4 | 1.4447E5 | |
|
3.4429E5 | 4.0432E4 | 7.8406E4 | 8.52 | 1 | 797 | 809 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.SDEVTQEISDETR.V | Y | Y | 5.68 | 12.80 | 1.4 | 1.4447E5 | |
|
3.4429E5 | 4.0432E4 | 7.8406E4 | 8.52 | 1 | 804 | 816 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.ILESSQTLLSVLK.R | Y | Y | 5.70 | 3.38 | 0.6 | 1.4768E6 | |
|
2.2569E6 | 1.0182E6 | 1.1554E6 | 2.22 | 1 | 85 | 97 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.DLGLAQDSATSTK.T | Y | Y | 4.06 | 5.40 | 4.7 | 1.2988E6 | |
|
4.5203E5 | 1.4416E6 | 2.3633E6 | 5.23 | 1 | 282 | 294 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.DLGLAQDSATSTK.T | Y | Y | 4.06 | 5.40 | 4.7 | 1.2988E6 | |
|
4.5203E5 | 1.4416E6 | 2.3633E6 | 5.23 | 1 | 284 | 296 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.AVLLGPPGAGK.G | Y | Y | 4.66 | 11.19 | 0.3 | 1.7113E7 |  |
 |
3.2309E6 | 2.5136E7 | 2.2971E7 | 7.78 | 1 | 18 | 28 | |
| R.AMVASGSELGK.K | Y | Y | 3.72 | 5.27 | 3.3 | 9.0318E6 |  |
 |
2.2553E6 | 1.4528E7 | 1.3944E7 | 6.44 | 1 | 52 | 62 | |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| K.VQIAVANAQELLQR.M | Y | Y | 6.74 | 2.44 | 0.4 | 1.2764E7 |  |
 |
7.6585E6 | 1.4585E7 | 1.6049E7 | 2.10 | 1 | 28 | 41 | |
| K.C(+57.02)IGKPGGSLDNSEQK.C | Y | Y | 6.25 | 4.45 | 1.0 | 1.8107E6 |  |
 |
1.1299E6 | 2.3274E6 | 2.5567E6 | 2.26 | 1 | 50 | 64 | Carbamidomethylation |
| total 2 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.DPIPYLPPLEK.L | Y | Y | 4.48 | 3.86 | 0.7 | 8.5339E6 |  |
 |
3.7E6 | 1.3173E7 | 1.4105E7 | 3.81 | 1 | 17 | 27 | |
| K.MWDPHNDPNAQGDAFK.T | Y | Y | 6.41 | 4.17 | 1.9 | 5.1685E6 |  |
 |
2.5539E6 | 6.8898E6 | 6.0619E6 | 2.70 | 2 | 88 | 103 | |
| R.YDERPGPSPLPHR.D | Y | Y | 6.12 | 1.65 | 0.7 | 2.714E6 |  |
 |
2.0749E6 | 3.3804E6 | 3.5318E6 | 1.70 | 1 | 219 | 231 | |
| total 3 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.LIDDMVAQAMK.S | Y | Y | 3.81 | 1.16 | 8.7 | 3.338E6 |  |
 |
3.9921E6 | 3.9246E6 | 2.0973E6 | 1.90 | 1 | 250 | 260 | |
| K.SEGGFIWAC(+57.02)K.N | Y | Y | 6.07 | 13.68 | 0.9 | 2.5424E6 |  |
 |
5.3515E6 | 9.2861E5 | 1.347E6 | 5.76 | 1 | 261 | 270 | Carbamidomethylation |
| R.SDYLNTFEFMDK.L | N | Y | 5.09 | 9.54 | 1.0 | 2.4618E6 |  |
 |
5.1548E6 | 8.9766E5 | 1.3329E6 | 5.74 | 1 | 389 | 400 | |
| K.TVEAEAAHGTVTR.H | Y | Y | 11.17 | 5.98 | 0.7 | 2.7961E6 |  |
 |
5.8159E6 | 1.2862E6 | 1.6078E6 | 4.52 | 2 | 302 | 314 | |
| R.IIWELIK.E | N | Y | 4.47 | 4.84 | 0.5 | 1.8328E6 |  |
 |
3.82E6 | 6.1959E5 | 1.0588E6 | 6.17 | 1 | 21 | 27 | |
| R.FKDIFQEIYDK.Q | N | Y | 5.27 | 8.02 | 0.6 | 1.2602E6 |  |
 |
2.8328E6 | 3.1481E5 | 6.3286E5 | 9.00 | 1 | 223 | 233 | |
| total 6 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.IVVFQYSDGK.L | Y | Y | 4.75 | 3.08 | 0.7 | 5.1784E6 |  |
|
3.195E6 | 5.6098E6 | 6.7304E6 | 2.11 | 1 | 848 | 857 | |
| R.TVPLYESPR.K | Y | Y | 3.69 | 3.52 | 6.3 | 3.4768E6 |  |
 |
1.1842E6 | 5.1967E6 | 4.0494E6 | 4.39 | 1 | 714 | 722 | |
| K.IC(+57.02)YQEVSQC(+57.02)FGVLSSR.I | Y | Y | 6.83 | 1.84 | 1.0 | 1.9219E6 |  |
 |
1.2317E6 | 2.2716E6 | 2.2622E6 | 1.84 | 1 | 724 | 739 | Carbamidomethylation |
| R.KIC(+57.02)YQEVSQC(+57.02)FGVLSSR.I | N | Y | 8.96 | 2.02 | 0.9 | 1.7286E6 |  |
 |
1.233E6 | 1.6203E6 | 2.3326E6 | 1.89 | 1 | 723 | 739 | Carbamidomethylation |
| total 4 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SQWSPALTISK.V | Y | Y | 6.28 | 5.01 | 0.7 | 3.1225E7 | |
|
1.3438E7 | 3.5824E7 | 4.4413E7 | 3.31 | 1 | 91 | 101 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SQWSPALTISK.V | Y | Y | 6.28 | 5.01 | 0.7 | 3.1225E7 | |
|
1.3438E7 | 3.5824E7 | 4.4413E7 | 3.31 | 1 | 90 | 100 | |
| total 1 peptides |
| Peptide | Used | Candidates | Quality | Significance | Avg. ppm | Avg. Area | Sample Profile | Group Profile | Parent | Set3 | Set5 | Max Ratio | #Vector | Start | End | PTM |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| R.SQWSPALTISK.V | Y | Y | 6.28 | 5.01 | 0.7 | 3.1225E7 | |
|
1.3438E7 | 3.5824E7 | 4.4413E7 | 3.31 | 1 | 91 | 101 | |
| total 1 peptides |
